(data stored in ACNUC7421 zone)

EMBL: CP002299.PE565

CP002299.PE565       Location/Qualifiers
FT   CDS_pept        718195..719292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0575"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: sen:SACE_3888 CorA-like putative magnesium transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78653"
FT                   /db_xref="GOA:E3JBC3"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC3"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ADP78653.1"
FT                   /translation="MGDATAGNPGRPGGTVGWNGSSNLACRVDPDADPTNRVGREPPRT
FT                   RVYRAGKLEAEGFPVARVSDYLEEPDTVVWLDLCAPRPDELHVISEELNLSSLAVEDAV
FT                   SPRERPKLDRYDSHLFLNAYSVSFDRDSGEVATHEVAAFITQKALVTVRQDEGFDVDGL
FT                   LAHWGEVGQELGQYGVSYLVHGLLDFIVDQHFAAVQSLDTEIETLEDLLFDDAPHDGAV
FT                   QRRSYELRKSLVLLRRVVLPMREVVNTIMRRDLHLVSPEIAPYYQDVYDHVLRATEWTE
FT                   SLRDLVTTILETNLTIQGNRMNLIMKRLSAWAAVIAVPTAITGFYGQNVPYPGFGKEWG
FT                   FAVSVGVLLGCAGFLYVAFKRRDWL"
     atgggtgacg cgacggcggg gaatccgggc cggccgggcg gaacggtggg ttggaacggg        60
     tcctcgaatc tcgcgtgccg ggtggacccg gatgccgatc cgacgaaccg ggtcggccgc       120
     gagccacctc ggaccagggt ctaccgggcc ggcaagctgg aggccgaggg cttcccggtc       180
     gcccgggtca gcgactatct ggaggagccc gacaccgtcg tctggctcga cctgtgcgcg       240
     ccgcgaccgg acgagctgca cgtcatcagc gaggagctga acctctcgtc gctggcggtc       300
     gaggatgccg tcagcccgcg tgagcgcccg aagctggacc ggtacgacag ccatctgttc       360
     ctgaacgcct actcggtgag cttcgaccgg gacagcggcg aggtggccac gcacgaggtc       420
     gccgcgttca tcacgcaaaa ggcgctggtg accgtgcgcc aggacgaggg cttcgacgtc       480
     gacggcctgc tcgcgcactg gggcgaggtc ggccaggaac tcggccagta cggcgtcagc       540
     tacctggtgc acgggctgct cgacttcatc gtcgaccagc atttcgccgc cgtgcagagc       600
     ctcgacacgg agatcgagac gctggaggac ctgctgttcg acgacgcgcc gcacgacggc       660
     gccgtccagc ggcgcagcta cgaactgcgc aagagcctgg tgctgctgcg ccgggtggtc       720
     ctcccgatgc gcgaggtcgt caacacgatc atgcgtcggg acctgcatct ggtcagcccc       780
     gagatcgcgc cctactacca ggacgtctac gaccacgtgc tgcgcgccac ggagtggacc       840
     gagagcctgc gggacctggt caccacgatc ctggagacga acctgaccat ccagggcaac       900
     cggatgaacc tcatcatgaa acggctgagc gcctgggccg cggttattgc cgtgcccacc       960
     gcgatcaccg gtttctacgg ccagaacgtt ccctatccgg gcttcggcaa ggaatggggc      1020
     ttcgccgtca gcgtcggcgt ccttctcggc tgcgctggct ttctctacgt cgccttcaaa      1080
     cgccgcgact ggttgtag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page