(data stored in ACNUC7421 zone)

EMBL: CP002299.PE570

CP002299.PE570       Location/Qualifiers
FT   CDS_pept        726005..727447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0580"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: fal:FRAAL1479
FT                   putative O-acetyl-transferase; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78658"
FT                   /db_xref="GOA:E3JBC8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC8"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADP78658.1"
FT                   /translation="MGLGLAARPLSTAFNRSGNSLNMIRLLLAATVVISHSRTIAGHGD
FT                   GISIGHGEIAKFAVDAFFVISGFLITGSRLGLPTGRYLWNRILRIFPAFWAALLGTAFL
FT                   AAPIAWYHDHNSLGGLFTDAHGPVQYVLRNCLLDIGFWDVAGTPAHVPFPAVWDGSIWT
FT                   LRWEVACYLGIAALGAVGLLARRGVVLGIFGVMWAAYAFHDVAPSVAGGAFAHQQTVTR
FT                   FALLFLSGTLMCLFQDKIPFSDALGALALVEVAVAYVALDHAYIWAGPPLAYACLWVAT
FT                   RVPMPKLLRNDFSYGLYIFTMPVQQLLAVFGLAKGSLTVYTVLSLSGGLALAALSWFGL
FT                   EKRVLKLKNFTPGFLKDKGAAAGAHRRLRRPPGMRASTMVIPMPEEIRSAMTGSGRAEP
FT                   SRRGASRPAQAPAPAQAESGRSRSRRRSGSDRPVPPAPPPPPGRVDETMLLLPASGVEE
FT                   TMRLPPQPSVDDTVRLRRGRQR"
     gtgggactcg gactggccgc tcgcccgctc agcacggcct tcaatcggtc tggtaacagc        60
     ctgaacatga ttcggctgtt actggccgcg accgtggtca tctcgcacag ccggacgatc       120
     gccggccacg gcgacggcat cagcatcggg cacggcgaga tcgcgaagtt cgcggtcgac       180
     gcgtttttcg tgatcagcgg tttcctcatc accggcagcc ggctcggtct tccgaccggc       240
     cggtacctgt ggaaccggat actccggatc tttcccgcgt tctgggcggc actgctcggc       300
     accgcgttcc tcgccgcgcc catcgcctgg taccacgacc acaactcgct cggcggcctc       360
     ttcaccgacg cgcacggccc ggtccagtac gtgctgcgca actgcctgct cgacatcggg       420
     ttctgggatg tcgcgggcac gccggcgcac gtcccgttcc cggccgtctg ggacggctcg       480
     atctggacgc tgcgctggga ggtcgcctgc tacctcggta tcgccgcgct gggagcggtc       540
     gggctgctcg cccggcgtgg agtcgtgctc ggcatcttcg gcgtgatgtg ggcggcatac       600
     gcgttccacg acgtcgcgcc gtcggtcgcg ggaggtgcct tcgcgcacca gcagacggtg       660
     acccggttcg cgctgctgtt cctgtccggc acacttatgt gcctcttcca ggacaagatc       720
     ccgttctcgg acgcactcgg cgccctcgcg ctggtggagg tggccgtcgc ctacgtggcc       780
     ctcgaccacg cctacatctg ggccggtccg ccgctggcgt acgcgtgcct gtgggtggcg       840
     acccgggtgc cgatgcccaa gctgctgcgc aacgacttct cctacggtct gtatatcttc       900
     acgatgccgg tgcagcagct cctcgctgtg ttcgggctgg ccaagggaag tctcacggtc       960
     tacaccgtcc tcagcctgtc tggcggcctc gcgctcgcgg ccctcagctg gttcggcctg      1020
     gagaaacgtg tcttgaagct gaagaacttc acccctggtt tcctgaagga caagggtgcg      1080
     gccgccggcg cccaccggcg gctgcggcgt ccgcccggca tgcgcgcgtc cacgatggtc      1140
     atcccgatgc ccgaggagat ccggtcggcc atgaccgggt ccggccgagc cgagccgagc      1200
     cggcgtggcg ccagccggcc ggcccaggcg ccggcgccgg cccaggccga gtcgggcagg      1260
     tcccggtctc ggcgtcggtc gggatcggac cggccggtgc cgccggcgcc cccgcccccg      1320
     ccagggcgcg tcgatgaaac gatgctgctg ctcccggcaa gcggagtgga ggagaccatg      1380
     cggctccccc cgcagccgtc ggtcgacgac acggtgcgac tccgccgcgg ccgccagcgc      1440
     tga                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page