(data stored in ACNUC7421 zone)

EMBL: CP002299.PE571

CP002299.PE571       Location/Qualifiers
FT   CDS_pept        complement(727510..730242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0581"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /EC_number="3.6.1.17"
FT                   /note="KEGG: fal:FRAAL0280 serine/threonine protein
FT                   phosphatase; PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78659"
FT                   /db_xref="GOA:E3JBC9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032380"
FT                   /db_xref="InterPro:IPR032390"
FT                   /db_xref="InterPro:IPR041780"
FT                   /db_xref="UniProtKB/TrEMBL:E3JBC9"
FT                   /inference="protein motif:PRIAM:3.6.1.17"
FT                   /protein_id="ADP78659.1"
FT                   /translation="MTLEEPEKMTEGPEPATPVALDIPETCLVVLVGVSGSGKSTFART
FT                   HFAPTQVLSSDFCRGLVADDENDQAATGDAFEVLHYIAGKRLAAGRLTVVDATNVQSRA
FT                   RQPLVELARRHDVLPVAIVLDLPEQVCLARNSARPDRDFGAAVIRRQRSELRRSMKGLA
FT                   REGFRRVHVLRSEAEVAAATISYTRLFTDLRHETGPFDVIGDVHGCRAELEGLLVKLGY
FT                   ELSRDDAGRPVGASHPEGRRVIYVGDLVDRGPDTPGVLRLAMGMVADGTAFAVRGNHED
FT                   KLVRALAGKKVTIGHGLAESLEQLGAQSAEFRAQATEFCDGLIAHYVLDGGRLVVAHAG
FT                   LKEVYHGRASARVRSFALYGDTTGETDAYGLPVRYPWANEYRGKATVLYGHTPVPEPEW
FT                   INNTLCLDTGCVFGGALTALRYPERELVSLPAARVYFEPARPLADQPPPTDSPGLSEAA
FT                   PSVDVDPASAEALLAPLGPALPAAARPAGHRADDLLDITDVLGRRIVETRHGGRVQVQP
FT                   ENALAALEVMSRFAVDPRWLVYLPPTMSPPPTSSLPGYLEHPLEAFETYRADGVDDLLC
FT                   EEKHMGSRAAVVVCRDQGVATARFGAGDGTTGAIVTRTGRPFFAPELTEQVLARLRAAA
FT                   TVAGLWEQLDAGWLVLDAEIMPWSAKATELISRQYAAAGAAARGALPAAVAALAATAER
FT                   GIDVADLLAKTRDRLDNAVAFTHAYRRYCWPVDGLDGLKIAPFQLLAAGPASGAGATQV
FT                   DHPHSWQLALADRLVAADPELVVTTRRYAVRASDPASVAAAVTWWEDLTDPRAGGEGMV
FT                   VKPAAGLARGSRGLALPGIKVRGREYLRIIYGPDYTRPENLDRLRVRGLGRKRSLAFRE
FT                   FALGLEALERAAAGEPLWRVHECVFAILALESEAVDPRL"
     atgaccctgg aagagcccga aaagatgacc gaaggacccg agccggcaac gccggtggcg        60
     ctggacatcc ccgagacctg cctggtcgtc ctcgtcggcg tctcggggtc ggggaagtcg       120
     accttcgccc ggacccattt cgcgccgacc caggtgctct cgtccgactt ctgccgcggc       180
     ctggtcgcgg acgacgagaa cgaccaggcc gcgaccggcg acgccttcga ggtgctgcac       240
     tacatcgccg gcaagcggct cgcggccggc cggctcaccg tcgtcgacgc gaccaacgtc       300
     cagtcccgcg cccgccagcc gctggtcgag ctggccaggc ggcacgacgt gctgccggtg       360
     gcgatcgtgc tcgacctgcc cgagcaggtg tgcctcgcgc gcaactccgc ccggccggac       420
     cgcgacttcg gggcggcggt catccgccgc cagcgctccg agctgcgccg gtcgatgaag       480
     ggcctcgccc gggagggctt ccggcgggtc cacgtgctgc gctccgaggc cgaggtcgcc       540
     gccgcgacga tcagctacac ccggctgttc accgacctgc gccacgagac cgggccgttc       600
     gacgtgatcg gcgacgtcca cggctgccgc gccgagctgg aggggctgct cgtcaagctc       660
     ggctacgagc tgagccgcga cgacgccggc cggccggtcg gcgcgagcca ccccgagggc       720
     cgacgggtga tctacgtcgg cgacctggtc gaccgcgggc cggacacccc cggcgtgctg       780
     cgcctggcga tgggcatggt cgccgacggg accgcgttcg ccgtccgggg caaccacgag       840
     gacaagctgg tccgggccct ggccggcaag aaggtgacga tcgggcacgg cctcgccgag       900
     tcactcgagc agctcggggc gcagagcgcc gagttccgcg cgcaggccac cgagttctgc       960
     gacgggctga tcgcgcacta cgtcctggac gggggccggc tggtcgtcgc ccacgccggg      1020
     ctgaaggagg tctaccacgg ccgggcgtcc gctcgggtgc gctcgttcgc cctgtacggc      1080
     gacaccaccg gcgagaccga cgcctacggc ctgccggtgc gatatccgtg ggccaacgag      1140
     taccggggca aggcgaccgt gctctacggc cacaccccgg tgcccgagcc agagtggatc      1200
     aacaacaccc tctgtctcga caccggctgc gtcttcggcg gcgcgctcac cgccctgcgc      1260
     taccccgagc gcgagctggt ctccctcccg gctgcccgcg tctacttcga gccggcccgc      1320
     ccgctggccg accagccacc gcccacggac tccccagggt tgagcgaggc cgcgccgtcg      1380
     gtggatgtcg acccggcctc ggccgaggcg ctgctcgctc ccctcggccc ggcgcttccc      1440
     gccgcggcgc ggcccgccgg gcaccgtgcg gacgacctgc tcgacatcac cgacgtgctg      1500
     gggcggcgga tcgtcgagac acggcacggc ggccgggtcc aggtccagcc ggagaacgcg      1560
     ctggcggcgc tggaggtcat gagccggttc gcggtggacc cgcgctggct ggtctacctc      1620
     ccgccgacga tgagcccgcc gccgacctcg tcgctgcccg gctatctgga acacccgctc      1680
     gaggccttcg agacctaccg cgccgacggg gtcgacgatc ttctctgcga ggagaagcac      1740
     atgggctccc gggcggcggt cgtcgtctgc cgggaccagg gggtcgcgac ggcccggttc      1800
     ggcgcgggcg acggcaccac gggcgcgatc gtcacccgga ccggccggcc gttcttcgcc      1860
     ccggagctca ccgagcaggt actggcccgg ctgcgcgcgg cggcgacggt ggccgggctc      1920
     tgggagcagc tcgacgccgg ctggctggtg ctcgacgccg agatcatgcc ctggtccgcc      1980
     aaggccaccg agctgatctc ccgccagtac gcggcggccg gagcggccgc ccgcggcgcg      2040
     ctgccggcgg cggtcgcggc gctcgcggcc acggccgaac gcggcatcga cgtggccgac      2100
     ctgctggcca agacgcgcga ccggctggac aacgcggtcg cgttcacgca cgcctatcgc      2160
     cggtactgct ggccggtcga cggcctcgac gggctgaaga tcgccccgtt ccagctcctg      2220
     gccgccggcc cggccagcgg tgccggcgcc acccaggtgg atcacccgca cagctggcag      2280
     ctggccctcg ccgaccgtct cgtcgccgcc gacccggagc tggtcgtcac cacccgcagg      2340
     tacgcggtgc gcgcgagcga cccggcgtcg gtggccgcgg ccgtcacctg gtgggaggac      2400
     ctgaccgacc cccgggccgg cggcgagggc atggtcgtca agccggccgc cggcctggcc      2460
     cggggctcac gcggcctggc cctgccgggc atcaaggtcc gcggccggga gtacctgcgg      2520
     atcatctacg gccccgacta caccaggccc gagaacctgg accggctacg cgtgcgcggc      2580
     ctgggccgca agcgctcgtt ggccttccgc gagttcgcgc tcgggctgga ggcgctggag      2640
     cgggcggccg ccggcgagcc cctctggcgc gtgcacgaat gcgtcttcgc catcctcgcc      2700
     ctggagtccg aggccgtaga cccccgcctg tag                                   2733
//

If you have problems or comments...

PBIL Back to PBIL home page