(data stored in ACNUC7421 zone)

EMBL: CP002299.PE573

CP002299.PE573       Location/Qualifiers
FT   CDS_pept        732224..733921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0583"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   fal:FRAAL2998 amino acid/polyamine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78661"
FT                   /db_xref="GOA:E3JCG5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E3JCG5"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADP78661.1"
FT                   /translation="MYGSQPAARHRAVAVPSPSTPGRETGSAGPGQAPPGSPDPTRGPG
FT                   SGMAPRLGLVGLTFVSLGSIIGSGWLLGALTAARVAGPASLVAWALAGVLILGLALVHA
FT                   ELGASYPVAGGSARYTHLALGPLSGFVAGWLAWIQAVALAPIEAEAALSYLNNVWPGLI
FT                   SPQGTLTGKGLALGAAALGVCTVVNVLGVQRLADTNSVAVIWKFLVPVLTVITLMAVAF
FT                   HPGNFHAGGGFAPFGAHGVFAALPAGVVFALQGFEQAVQMGAEARDPGRDVPRAVILAT
FT                   VLGTAVYLLLAIAFLGALSPAGIAGGWSHPVGNGDYGPYATIATGLGLGWLAVLLYIDA
FT                   VVSPGGTALIYVGTSARLAYSMGQTGYLPRALRRLDRRGTPVVSILLAYAIGLVMFLPF
FT                   PSWQQLVTLISSATFLTYAFAPVALMVLRKVDPDRPRPFRLPLAPLLARVAFTTSNLIV
FT                   YWAGWENDQKLAVAIFAGLVCFTGYRATQPPGRWPPLEWRSALWIVPWLGGLTIISWLG
FT                   QFGSGRGVIPFWVDLGVIVVFSLAVFELAIRVTPPAARSRALLETELA"
     atgtacggaa gccaaccggc cgcgaggcac cgcgccgtcg cggtgccgtc gccttcgacg        60
     cctggacggg agacgggctc ggccgggccc ggccaggctc cgcccggatc gcccgacccg       120
     acgcgtggcc ccggcagcgg gatggccccg cggctgggcc tggtggggct gaccttcgtc       180
     tcgctcggct cgatcatcgg ctccggctgg ctgctcggag cgctgaccgc ggcccgcgtc       240
     gccggcccgg cctcgctggt cgcctgggcg ctcgccggcg tcctgatcct cggcctggcg       300
     ctcgtccacg ccgagctggg agcgagctac ccggtcgccg gcggcagcgc ccgctacacg       360
     cacctcgcgc tcggcccgct gtccggcttc gtggccggct ggctcgcctg gatccaggcg       420
     gtcgcgctcg ccccgatcga ggccgaggcg gccttgtcct acctgaacaa cgtctggccc       480
     ggcctgatca gcccgcaggg caccctcacc gggaagggcc tcgcgctggg cgccgcggcg       540
     ctcggggtct gcaccgtggt gaacgtcctc ggcgtccagc ggctcgcgga caccaactcg       600
     gtcgcggtga tctggaagtt cctggtgccg gtgctgaccg tcatcacgct gatggccgtc       660
     gccttccacc ccggcaactt ccacgcgggc ggcgggttcg ccccgttcgg cgcgcacggg       720
     gtgttcgccg cgctgccggc cggcgttgtc ttcgcgctgc agggcttcga gcaggccgtc       780
     cagatgggcg ccgaggcgcg cgacccgggc cgcgacgtcc cgcgcgcggt gatcctcgcg       840
     accgtgctcg gcaccgccgt ctacctgctg ctcgcgatcg ccttcctcgg cgcgctctcg       900
     ccggcgggta tcgcgggcgg ctggtcgcac ccggtgggca acggcgacta cgggccgtac       960
     gcgacgatcg cgaccgggct gggcctcggc tggctcgcgg tgctgctgta catcgacgcg      1020
     gtcgtctcgc cgggcggcac ggcgctgatc tacgtcggca cgtcggcccg cctcgcctac      1080
     tcgatgggcc agaccggcta cctgccacgc gcgctgcgcc gcctcgaccg gcgcggcacg      1140
     ccggtggtct cgatcctgct cgcgtacgcg atcgggctgg tcatgttcct gccgttcccc      1200
     agctggcagc agctggtgac cctgatcagc tcggcgacct tcctgaccta cgcgttcgcg      1260
     ccggtcgcgc tgatggtgct gcgcaaggtc gacccggacc gtccccggcc gttccggttg      1320
     ccgctggcgc cgctgctggc ccgggtcgcg ttcaccacct cgaacctgat cgtctactgg      1380
     gccggctggg agaacgacca gaagctggcg gtggcgatct tcgccgggct ggtctgtttc      1440
     accgggtacc gggccaccca gccgcccggc cgctggccgc cgctggaatg gcgatccgcg      1500
     ctgtggatcg ttccttggct gggaggtctg accatcatct cctggctggg ccagttcggc      1560
     agtgggcgcg gtgtcatccc gttctgggtc gatctcggcg tgatcgtcgt cttcagcctc      1620
     gccgtcttcg agctggccat ccgcgtcacg ccacccgccg ctcgatcccg ggcgctgctc      1680
     gagaccgagc tggcctga                                                    1698
//

If you have problems or comments...

PBIL Back to PBIL home page