(data stored in ACNUC7421 zone)

EMBL: CP002299.PE60

CP002299.PE60        Location/Qualifiers
FT   CDS_pept        66315..67019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_5865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78148"
FT                   /db_xref="GOA:E3J3E6"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3E6"
FT                   /inference="similar to AA sequence:KEGG:Kfla_5865"
FT                   /protein_id="ADP78148.1"
FT                   /translation="MELPDSLPAQLYLLTYNPESERMAGRHRSGYLGPGLRAAAVLELE
FT                   RRGRVAVADGKVVPVAPERRPAVAAGPGVAMLPDDPILTRVLDQIEGSGRHRSLRHWIA
FT                   KDNRVTTRCARDYLEAGRWLRVDRYRVIGLIPRTSVTVRDTRLVRKLIGDVRQTLVGAA
FT                   PAARVADRDRQLAALGVLAEMGVLFSRRERRAHRDRARELVADLGPVGEALRKVVRDQK
FT                   ADAAAAAATSGG"
     gtggagctgc ccgactcact gccggcccag ctgtacctgc tgacctacaa ccccgagagc        60
     gaacggatgg ccggccggca caggtccggc tacctgggcc ccggcctgcg cgcggccgcc       120
     gtgctggagc tggaacggcg cgggcgggtc gccgtggccg acggaaaggt cgtgccggtc       180
     gcccctgagc ggcgcccggc ggtggcggcc gggcccggcg tggccatgct tcccgacgat       240
     ccgatcctga cgcgggtgct cgaccagatc gagggctcgg ggcgccatcg gtccctgcgg       300
     cactggatcg cgaaggacaa ccgggtcacg acccggtgcg cccgcgacta cctggaggcg       360
     ggtcgctggc tacgcgtcga ccggtaccgg gtgatcgggc tgatcccgcg cacgagcgtg       420
     accgtgcgcg acaccaggct ggtccggaag ctgatcggcg acgtgcgtca gacgttggta       480
     ggcgcggcgc cggccgcccg ggtcgccgac cgcgaccgcc agctcgccgc cctcggcgtg       540
     ctcgccgaga tgggcgtcct gttctccagg cgggagcggc gcgcccaccg ggaccgggcg       600
     cgcgagctcg tggcggacct cgggccggtc ggcgaggcgc tgcgcaaggt cgtccgtgac       660
     cagaaggccg acgcggccgc cgctgccgcc accagcggag gctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page