(data stored in ACNUC7421 zone)

EMBL: CP002299.PE64

CP002299.PE64        Location/Qualifiers
FT   CDS_pept        complement(70301..71116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0064"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   KEGG: fal:FRAAL6784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78152"
FT                   /db_xref="GOA:E3J3F0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F0"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADP78152.1"
FT                   /translation="MAATRYPSATWRPVVNTSGTMIEPTRGLIPHVQQGNGSLYGMFNT
FT                   PSTQVSSHLWLSKGGGWEQYVDLADKAWAEAAGNPYWISVECEGFDTEDYSPIQVQRLA
FT                   EFYAWGMTEFGWKAEITDSVDGYGIGTHRMGGTAWGGHSCPGDIRANRRQDVLSAALAL
FT                   NGTPPPTPNPSQAQQRYVNMPTLRSGSKGSAVVTLQNALNIIFGHEAPTGDPNRLVPDG
FT                   SFGPATLARVGSLQRLNSPYYGPIGVDGVVGRQTWLKIGYILTGMNRSV"
     atggccgcca cccgttatcc gtcggccacc tggcgccccg tcgtcaacac gtccggcacc        60
     atgatcgagc caacgcgggg cctcatcccg cacgtccagc agggcaacgg ctcgctctac       120
     ggcatgttca acaccccgag cacccaggtc tccagccatc tgtggctgtc caagggcggc       180
     ggctgggaac agtacgtcga cctcgccgac aaggcctggg ccgaggcggc cggcaacccg       240
     tactggatct cggtggagtg cgagggcttc gacaccgagg actactcgcc gatccaggtc       300
     cagcggctcg ccgagttcta cgcctggggc atgaccgagt tcggctggaa agccgagatc       360
     accgacagcg tcgacgggta cggcatcggg acgcaccgga tgggcggcac agcctggggc       420
     ggccattcct gccccggcga catccgcgcc aaccggcgcc aggacgtcct ctcggccgcg       480
     ctggcgctga acggcacccc gccgcccacg cccaacccgt cccaggccca gcagcgctac       540
     gtcaacatgc cgacgctgcg cagcggcagc aagggctcgg ccgtcgtcac gctgcagaac       600
     gcgctgaaca tcatcttcgg ccacgaggct ccgaccggcg acccgaaccg gctcgtcccg       660
     gacggcagct tcggcccggc gaccctcgcc cgggtcggtt cgctgcagcg gctgaactcg       720
     ccgtactacg gcccgatcgg ggtcgacggc gtcgtcggcc ggcagacctg gctgaagatc       780
     ggctacatcc tcaccggcat gaaccgctcg gtctga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page