(data stored in ACNUC7421 zone)

EMBL: CP002299.PE65

CP002299.PE65        Location/Qualifiers
FT   CDS_pept        71634..72650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0065"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   fal:FRAAL6783 putative N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78153"
FT                   /db_xref="GOA:E3J3F1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADP78153.1"
FT                   /translation="MLPGPPPAAARALRTAVFVEEQGVPAELEHDAADLAADHAVVWDE
FT                   AGEALATARLLDPAAIPDLDLGPAPVGPVPDGPVANRFGESVGVIGRVAVRPDARGRGL
FT                   ARAVTIALERRAAERGLTGIRLHAQAAVAGLYLGLGYETFGPPDRTAGIDHVWMRRSIL
FT                   PGLRPVRDDDGPAVQRLIGAVWAEYPGCVLDVDGEEPWMRAPATAYTGDLDPARYRGRM
FT                   WVVEDRAVEDEDAGRPGVLAASVAVRETAPGRVELKSLYVAASARRRGLGQALVFLVER
FT                   EARRRDAQVVELWSDTRFSDAHRLYERLGYRGAGRTRDLHDLSNTTEIHFTKDLLSE"
     gtgctgcccg gcccgccccc agcggcggcg cgggcgctgc ggacggccgt cttcgtcgag        60
     gagcagggcg tcccggccga gcttgagcac gacgcggcgg acctcgccgc cgaccacgcc       120
     gtcgtctggg atgaggccgg cgaggcgctc gcgaccgccc gcctgctgga cccggccgcc       180
     attcccgatc tcgacctggg tccggcgccg gtcgggccgg tgccggacgg tccggtcgcc       240
     aaccgcttcg gcgagtccgt cggggtcatc gggcgggtcg cggtccggcc ggacgcgcgt       300
     ggtcgtgggc tggccagggc ggtgacgatc gcgctggagc gccgcgcggc cgagcgtggc       360
     ctcaccggca tccgcctgca cgcgcaggcg gccgtggccg ggctctacct cggcctcggc       420
     tacgagacct tcgggccgcc cgaccggacc gccggcatcg atcacgtctg gatgcgccgg       480
     tcgatcctgc cggggctgcg gccggtccgg gacgacgacg ggccggcggt gcagcggctg       540
     atcggcgcgg tctgggccga gtacccgggc tgcgtcctcg atgtcgacgg cgaggagccg       600
     tggatgcgtg ccccggcgac ggcgtacacc ggagacctgg atcccgcccg ctaccgcggc       660
     cgcatgtggg tcgtcgagga cagggccgtc gaggacgagg acgccgggcg gcctggcgtg       720
     ctcgccgcca gcgtcgcggt gcgcgagacc gcgcccggcc gggtcgagct gaagtcgctc       780
     tacgtcgcgg cgagcgcccg gcggcgcggg ctcggtcagg ccctcgtctt cctggtggag       840
     cgggaggctc ggcgccggga cgcccaggtg gtcgagctgt ggtccgacac ccgcttctcg       900
     gacgcgcacc ggctctacga gcggttgggt taccgcggcg ccgggcggac ccgcgacctc       960
     catgatctct ccaacacgac cgagatccac ttcaccaagg atctactgag cgagtaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page