(data stored in ACNUC7421 zone)

EMBL: CP002299.PE69

CP002299.PE69        Location/Qualifiers
FT   CDS_pept        complement(78051..79271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0069"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   tcu:Tcur_1472 acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78157"
FT                   /db_xref="GOA:E3J3F5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3F5"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADP78157.1"
FT                   /translation="MPEAVIVATARSPIGRAFKGSLKDLHPDDLAATIVRAVLDKVPAL
FT                   DPTTIDDLMLGCAQPAGEQGFNMARAVAVQLGFDFLPGTTVNRYCSSSLQTTRMAFHAI
FT                   KAGEGDTFISAGVEMVSRFGKGSADNLPDTHNPRYADAEARTKARAEAGAPVWTDPHEA
FT                   GLLPDIYIAMGQTAENVVQYTGLTRADQDEFALRSQQNAAKAIADGFFEREITPVTLPD
FT                   GTVVSTDDGPRPSTTLEALAALKPVFRPDGSVTAGNACPLNDGAAAVVVMSDTRARELG
FT                   LTPLARIIATGVTGLSPEIMGLGPIGAVRQVLGRAGMTIDDVDLVEINEAFAAQVVPSA
FT                   RELNIDFDKLNVHGGGIALGHPFGSTGARILTTLLNGLRTRDKTIGLETMCVGGGQGMA
FT                   MLVERLS"
     gtgcccgagg ctgtcatcgt cgccaccgcc cggtccccga tcggccgcgc gttcaaggga        60
     tcgctgaagg acctgcaccc cgacgacctc gcggccacca tcgtgcgggc cgtcctcgac       120
     aaggtcccgg cgctcgaccc gacgaccatc gacgacctga tgctcggctg cgcccagccg       180
     gccggcgagc agggcttcaa catggcccgg gcggtcgccg tccagctcgg gttcgacttc       240
     ctgcccggca cgacggtgaa ccgctactgc tcctcgtcgc tgcagaccac gcggatggcc       300
     ttccacgcga tcaaggctgg cgagggcgac acgttcatct ccgccggggt cgagatggtc       360
     agccgcttcg gcaagggcag cgccgacaac ctgcccgaca cgcacaaccc gcgctacgcc       420
     gacgccgagg cgcgcaccaa ggcccgggcc gaggccggcg ctccggtctg gactgacccg       480
     cacgaggccg gcctgctgcc cgacatctac atcgccatgg gccagaccgc cgagaacgtc       540
     gtccagtaca ccggcctgac cagggccgat caggacgagt tcgcgctgcg ctcgcagcag       600
     aacgccgcca aggcgatcgc cgacggcttc ttcgagcgcg agatcacccc ggtcaccctg       660
     ccggacggca cggtcgtgtc gaccgacgac ggcccgcggc cgagtaccac gctggaggcg       720
     ctggccgcgc tcaagccggt cttccggccc gacggttcgg tgaccgccgg caacgcctgc       780
     cccctgaacg acggcgccgc cgcggtcgtg gtcatgagtg acacccgggc ccgcgagctg       840
     ggcctgaccc cgctcgcccg gatcatcgcc acgggcgtca ccggcctgtc ccccgagatc       900
     atgggcctcg gcccgatcgg cgcggtccgc caggtgctcg gccgggccgg catgacgatc       960
     gacgacgtcg acctggtcga gatcaacgag gcgttcgcgg cccaggtggt cccgtcggcc      1020
     cgcgagctga acatcgactt cgacaagctg aacgtgcacg gcggcgggat cgcgctcggc      1080
     cacccgttcg gctcgaccgg agcccgcatc ctgaccaccc tgctcaacgg cctgcgcacc      1140
     agggacaaga ccatcggcct ggagaccatg tgcgtcgggg gcggccaggg catggccatg      1200
     ctggtcgagc gcctcagcta g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page