(data stored in ACNUC7421 zone)

EMBL: CP002299.PE76

CP002299.PE76        Location/Qualifiers
FT   CDS_pept        89705..90877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0076"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: fal:FRAAL6764
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78164"
FT                   /db_xref="GOA:E3J3G2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G2"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADP78164.1"
FT                   /translation="MSVEEPGGPVSGSSEAEPAPSAAPSPWDRPTGAGTPPTMPKQSEP
FT                   GDSAPGQGHQQGWGAPQQGGSPGQWARDASGMPVWEGPRADEPSGRSTPGPGQPAPGLP
FT                   AAGGQAGQSNRCYRHPDRDAFVSCQRCGRPICPDCMRPAAVGFHCPEEAAAARTPASPT
FT                   QFGGRADRDSSGLITKILIGICLVAYVLEGVPGLTGTSHINQFTLDYSLIGVDIAQKHE
FT                   YWRLVTAAFLHGSVLHIAFNMYALFLLGTQLEAILGRVRYLALFFACAIGGNTLSYVIH
FT                   DEKAFSYGASTAIFGFFAAYYLIARRLRVNTNQILIVVGINLLITFSISGIDKWGHIGG
FT                   LATGVVLGLLYAYVPARRVAIQALGTVAVLAILVVAAVLNTQSLTALHTF"
     gtgagcgtcg aggagccggg cggaccggtg tccggttcga gcgaggccga gccggcgccc        60
     tccgccgcgc cgtcgccctg ggaccgccca accggcgcgg ggacgccgcc cacgatgccg       120
     aagcagagcg agccgggcga cagcgcgccc ggacagggcc accagcaggg ctggggagcc       180
     ccccagcagg gaggctcccc gggccagtgg gcccgcgacg cctccgggat gcccgtctgg       240
     gagggtcccc gggcggacga gccgtccggc cgttcgacgc ccggcccggg tcagcccgcg       300
     cctggcctcc cggcggcggg gggccaggcg ggccagtcga accggtgcta ccggcacccg       360
     gaccgcgacg cgttcgtctc ctgccagcgc tgcggccggc cgatctgccc ggactgcatg       420
     cgcccggccg ccgtcggctt ccactgcccg gaggaggcgg cggcggcccg cacgccggcg       480
     tcgccaaccc agttcggcgg ccgggcggac cgggactcct cgggcctgat cacgaagatc       540
     ctgatcggga tctgcctggt cgcctacgtg ctcgagggcg tgcccgggct gaccggcacc       600
     tcgcacatca accagttcac gctcgactac tcgctgatcg gcgtggacat cgcccagaag       660
     cacgagtact ggcggctggt cacggcggcg ttcctgcacg gcagcgtgct gcacatcgcg       720
     ttcaacatgt acgcgctgtt cctgctcggg acgcagctgg aggcgatcct cggccgagtg       780
     cgctatctgg cgctgttctt cgcctgcgcg atcggcggta acactctcag ctacgtgatc       840
     cacgacgaga aggccttctc ctacggggcc tcgaccgcga tcttcggctt cttcgccgcg       900
     tactacctca tcgcgcgtcg cctacgggtg aacacgaacc agatcctgat cgtcgtcggg       960
     atcaacctgt tgatcacgtt cagcatctcg ggcatcgaca aatggggcca catcggcggc      1020
     ctggcgacgg gcgtcgtgct gggcctgctc tacgcgtacg tgccggcgag gcgggtcgcc      1080
     atccaggcgc tcgggaccgt cgccgtcctc gcgatcctcg tcgtcgccgc ggtcctgaac      1140
     acccagagcc tgacggcgct gcacacgttc tga                                   1173
//

If you have problems or comments...

PBIL Back to PBIL home page