(data stored in ACNUC7421 zone)

EMBL: CP002299.PE77

CP002299.PE77        Location/Qualifiers
FT   CDS_pept        complement(90984..92105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0077"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   stp:Strop_3280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G3"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADP78165.1"
FT                   /translation="MTSTGPMLARRHGGSIMQASAAPGPLRGAGRARTSGDGPPTSAPS
FT                   ARSGQPAGPHRPGEVARPEESREATSPFSIANLTSVDSQFHSDGPFAPVGPVHPVELGG
FT                   PGGGLAPIGPGGFRPAGDLNERPSPAGVYDALLGGTAHRRVDRRSALAILLAWPDAPAA
FT                   ARAMKDFLVRAVRFAARNGVNQFLALGGGAGTVDPVHEVACAVAPESQTVYVEPDPLVI
FT                   ARSLPDIRDRQVALVQADVSRPAEVLRHPGVLAHLDVTQPIAIVMVPGLPEIADHEDPR
FT                   EVLRGYREVTARGSLLLFSQLCDEGSARGLRALFERAGQPGAPRPHEQTVELVSTWEPI
FT                   EPGLVPAEEWNAPDERGHPHFGRLPVYASVGWH"
     atgacctcca ccggaccgat gctcgccaga aggcacggcg gcagcatcat gcaggcttcc        60
     gcggcgcccg ggccgctccg cggcgccggc cgggccagga ccagcggcga cgggccaccg       120
     accagcgccc cgtccgcccg gtcaggtcag ccggccgggc cacacagacc cggcgaggtg       180
     gccagacccg aggagtcccg cgaggccacc agcccgttca gcatcgcgaa cctcacctcg       240
     gtcgacagcc agttccactc cgacggcccg ttcgccccgg tcgggccggt gcacccggtc       300
     gagttgggcg gtcccggcgg cggcctcgcc ccgatcgggc ccggtggatt ccgccccgcg       360
     ggcgacctga acgaacgccc gtcgccggcc ggggtgtacg acgcgctgct cggcggcacc       420
     gcgcaccggc gggtggaccg caggtccgcg ctggccatcc tgctggcctg gccggacgcg       480
     ccggccgccg cccgggcgat gaaggacttc ctggtcaggg cggtcaggtt cgcggcccgc       540
     aacggcgtga accagttcct cgcgctgggc ggcggggccg ggaccgtcga ccccgtgcac       600
     gaggtggcct gcgccgtcgc cccggagagc cagacggtgt acgtcgagcc ggacccgctg       660
     gtgattgccc ggtcgctgcc ggacatccgg gatcgccagg tcgcgctggt gcaggcggac       720
     gtctccaggc cggccgaggt gctgcggcat ccgggcgtgc tcgcccacct cgacgtcacc       780
     cagccgatcg ccatcgtgat ggtgcccggc ctgccggaga tcgccgacca cgaggatccg       840
     cgcgaggtgc tgcggggcta tcgggaggtc accgcgcgcg gcagcctgct gctgttcagc       900
     cagctgtgcg acgagggcag cgcgcgcggc ctgcgggcgc tgttcgaacg ggccggccag       960
     ccgggtgccc cccggccgca cgagcagacc gtcgagttgg tcagcacctg ggagccgatc      1020
     gagccgggcc tggtgcccgc cgaggagtgg aacgcgccgg acgagcgcgg gcacccgcac      1080
     ttcggccggc tcccggtgta cgcctccgtc ggctggcact ga                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page