(data stored in ACNUC7421 zone)

EMBL: CP002299.PE79

CP002299.PE79        Location/Qualifiers
FT   CDS_pept        94745..95116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78167"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6760"
FT                   /protein_id="ADP78167.1"
FT                   /translation="MAKLVVGGGRVEVVLSQAERLAALRGDVSAALDEIADVQVSPHPF
FT                   GELRGIRAPGTGVPGVIALGTWRHRGGKDFVAIYRRRPAVVVLLAAGCEFERLIVGVED
FT                   PDQTVAAIRAATGLVIGGA"
     gtggcgaagc tggtggtcgg gggcggacgg gtcgaggtcg tgctgagcca ggccgaacgt        60
     cttgcggcct tgcgtgggga cgtgtcggcg gcgctggacg agatagccga cgtccaggtc       120
     tcgccgcacc cgttcggcga gctgcgcggc atccgggctc cggggaccgg tgttcccggg       180
     gtgatcgccc tgggcacctg gcgccaccgc ggcggcaagg acttcgtcgc catctaccgg       240
     cgccggccgg ccgtggtcgt gctgctcgcg gccggctgtg agttcgaacg cctcatcgtc       300
     ggcgtcgagg acccggacca gacggtcgcc gccatccgcg cggcgaccgg cctggtcatt       360
     gggggagcgt ag                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page