(data stored in ACNUC7421 zone)

EMBL: CP002299.PE80

CP002299.PE80        Location/Qualifiers
FT   CDS_pept        complement(95250..95513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0080"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   scb:SCAB_45631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78168"
FT                   /db_xref="GOA:E3J3G6"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G6"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADP78168.1"
FT                   /translation="MPESRRRKPKKATAARPASTVTAKRRSPSPRWFGGMIMAFFLIGI
FT                   AYLLTYYFSNGGVLGMEALGGWNILIGFGFVVIGLGVATQWH"
     gtgcccgaat cgcgacggcg caagccgaaa aaggccactg cggcccgccc cgcctcgacg        60
     gtcaccgcga agcggcggtc accgtcgccc cggtggttcg gcgggatgat catggcgttc       120
     ttcctgatcg gaatcgccta cctgctgacg tactacttct ccaacggcgg cgtcctgggt       180
     atggaggcgc tgggcggctg gaacatcctc atcggctttg gttttgtggt gattggcctg       240
     ggcgtggcga cccagtggca ctga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page