(data stored in ACNUC7421 zone)

EMBL: CP002299.PE82

CP002299.PE82        Location/Qualifiers
FT   CDS_pept        complement(96546..97196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0082"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="KEGG: fal:FRAAL6756 para-aminobenzoate synthase
FT                   component II; TIGRFAM: glutamine amidotransferase of
FT                   anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78170"
FT                   /db_xref="GOA:E3J3G8"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G8"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADP78170.1"
FT                   /translation="MRILVVDNYDSFVFNLVQYLGQLDAECVVRRNDEVDPERVGELGV
FT                   DGVLLSPGPGTPEAAGMTIPMVTAASAAGLPVFGVCLGHQAIGVAFGATVDRAPELLHG
FT                   KTSVVHHNGAGVLADLPNPFVATRYHSLAVEAATLPPEIEITARTDSGVVMAMRHRTLP
FT                   IEGVQFHPESVLTQGGHLMLARWLDACGDGGASRALAPALSNEVETLRQAAFA"
     atgcgcatcc tggtcgtcga caactacgac tcgttcgtgt tcaacctggt ccagtacctg        60
     ggccagctgg acgcggagtg cgtcgtgcgg cgcaacgacg aggtcgaccc ggagcgggtc       120
     ggcgagctcg gtgtcgacgg cgtcctgctc tcccccggcc ccgggacgcc cgaggcggcc       180
     ggcatgacca tcccgatggt gaccgcggcg tcggccgccg ggctgccggt cttcggggtg       240
     tgcctcggtc accaggcgat cggcgtcgcg ttcggcgcga ccgtcgaccg ggcgcccgaa       300
     ctgctgcacg gcaagacgtc tgtcgtgcac cacaacggcg cgggggtgct cgccgacctg       360
     ccgaacccgt tcgtcgcgac gcggtaccac tcgctcgccg tcgaggccgc gacgctgccg       420
     ccggagatcg agatcaccgc ccggaccgac agcggcgtgg tgatggcgat gcgacaccgc       480
     acgctgccga tcgaaggggt gcagttccac cccgagtcgg tcctcaccca gggcgggcac       540
     ctgatgctcg cgcgctggtt ggacgcctgt ggcgacggcg gcgccagccg tgcgctcgct       600
     ccggcgctgt ccaacgaggt cgagaccctg cgccaggccg cgttcgcctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page