(data stored in ACNUC7421 zone)

EMBL: CP002299.PE83

CP002299.PE83        Location/Qualifiers
FT   CDS_pept        complement(97220..99244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0083"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="KEGG: fal:FRAAL6755 putative
FT                   serine/threonine-protein kinase; PFAM:
FT                   Serine/threonine-protein kinase-like domain; PASTA domain
FT                   containing protein; SMART: serine/threonine protein kinase;
FT                   Tyrosine-protein kinase, catalytic domain; PASTA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78171"
FT                   /db_xref="GOA:E3J3G9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3G9"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADP78171.1"
FT                   /translation="MTDVTDLYGTEPRLVGDRYELGAGIGYGGMAEVYRGRDIRLGRDV
FT                   AIKVLRSDLARDPNFLKRFQREAQSAAGLNHPAIVSVYDTGEDIINGTRLPYIVMEFVE
FT                   GRTLREVLQQEGPFPERRAMEITSDICAALDYSHRLGIIHRDVKPANVMLSPDGSVKVM
FT                   DFGIAKANNATSSTMTATQAVIGTAQYLSPEQAQGKKVDARSDVYSTGVLFYELLTGEP
FT                   PFRGDNPVAVAYQHVREIPDPPSRHNPQLSAAADAVTLHALEKEPDDRYASAGEMRDDL
FT                   ERALAGRRVVAQQSGRPTGGASAAATQIARGGYRDDPRTGGYDTYDRYGDTGYQDSGYE
FT                   AGAYRQSGETRTRGGYAPVGGYTDQFERFPPDDDRYGGSGGAAPPPQRGSNAWKWVLAG
FT                   LAVVLTFVVVSLVATSLLSNKGGGSGGGSSTDATIPTGLKGQPLTAVKNQLTDLGFTNI
FT                   TSTSQKVTDGTAPDTVIKIAPNEGSKVPLSTAISLTVAAAPDQKPVPDVVGQTASAAQA
FT                   ALTAAGFEVQQQPYSDSTNPPKQKPGRVEKTDPAAGQPWGVGTTVTIFVVSSQVNVGSY
FT                   IGQSVSSAQAALTQLGLNNTVQQQPSDQAPGTVIDQNPKNATVNRGDTITLVVAAQATS
FT                   SPTGTPSTGVTPTLPGLPTSGNTGGPGHGGGTATPSPTG"
     gtgactgacg tgacggactt gtacgggacg gaaccacgtc tcgtcggcga ccggtacgag        60
     ctgggcgccg gcatcggcta cggcggcatg gccgaggtgt accgagggcg ggacatccgg       120
     ctgggccgcg acgtggccat caaggtgctg cgctcggacc tcgcccgcga ccccaacttc       180
     ctcaagcgct tccagcgtga ggcgcagtcg gccgcgggcc tcaaccatcc ggcgatcgtg       240
     tcggtctacg acaccggcga agacatcatc aacggcaccc ggctgccgta catcgtgatg       300
     gagttcgtcg agggccggac cctgcgcgag gtgctgcagc aggagggccc gttcccggaa       360
     cgccgggcga tggagatcac ctccgacatc tgcgcggcgc tggactacag ccaccggctg       420
     ggcatcatcc accgggacgt caagccggcg aacgtgatgc tgtccccgga cggctcggtc       480
     aaggtgatgg acttcggcat cgccaaggcc aacaacgcga cctcgtcgac gatgaccgcc       540
     acgcaggccg tcatcggcac cgcccagtac ctctcgcccg agcaggccca gggcaagaag       600
     gtggacgcgc gcagcgacgt ctactcgacc ggggtgctgt tctacgagct gctcacgggc       660
     gagccgccgt tccggggcga caacccggtg gccgtcgcct accagcacgt ccgggagatc       720
     cccgacccgc cgtcgcggca caacccgcag ctgtcggcgg ccgcggacgc ggtcacgctg       780
     cacgcgctgg agaaggagcc ggacgaccgg tacgcgagcg ccggcgagat gcgcgacgat       840
     ctggagcggg ccctcgcggg ccgccgggtg gtcgcccagc agtccggccg cccgaccggt       900
     ggcgcctcgg ccgccgcgac ccagatcgcg cgcggcggct accgcgacga cccccggacc       960
     ggcggctacg acacctacga ccgctacggc gacaccggct accaggactc gggctacgag      1020
     gccggggcct accggcagag cggggagacc cgcacccgtg gtggctacgc ccccgtcggc      1080
     ggctacaccg accagttcga gcggttcccg ccggacgacg accggtacgg cggttccggc      1140
     ggcgcggcgc cgccaccgca gcgcggctcg aacgcctgga agtgggtgct ggctggcctc      1200
     gcggtcgtgc tcaccttcgt cgtcgtctcc ttggtcgcga cgtcgttgct gtccaacaag      1260
     ggcggcgggt cgggcggcgg ctcctcgacc gacgcgacga tcccgacggg cctgaaaggc      1320
     cagcccctga ccgccgtcaa gaaccagctg acggacctcg gcttcaccaa tatcaccagc      1380
     acgtcacaga aggtgaccga cgggaccgca cccgacacgg tcatcaagat cgcgccgaac      1440
     gagggctcca aggtcccgct gtcgacggcc atcagcctga cggtcgcggc ggcgccggac      1500
     cagaagcccg tcccggacgt cgtcggccag acggcgtcag cggcccaggc cgcgcttacg      1560
     gcggccgggt tcgaagtgca gcagcagccc tacagcgaca gcaccaaccc gcccaagcag      1620
     aagccgggcc gggtggagaa gaccgacccc gcggctggtc agccatgggg cgtgggaacc      1680
     acggtcacga tcttcgtggt cagctcgcag gtgaacgtcg gcagctacat cggccagtcg      1740
     gtctcgtcgg cccaggccgc cctgacgcag ctggggctga acaacacggt ccagcagcag      1800
     ccgagtgacc aggcgccggg caccgtcatc gaccagaatc cgaagaacgc caccgtgaac      1860
     cgtggggaca cgatcaccct ggtcgtggcc gcgcaggcca ccagcagccc gacaggcacg      1920
     ccgtccaccg gtgtgacgcc gacgctgcct ggcctgccga cctcgggtaa caccggcggc      1980
     cccggccacg gcggcgggac cgccaccccc agcccgaccg gctga                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page