(data stored in ACNUC7421 zone)

EMBL: CP002299.PE85

CP002299.PE85        Location/Qualifiers
FT   CDS_pept        complement(101048..102511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0085"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: fal:FRAAL6753 putative penicillin-binding protein
FT                   PbpA"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78173"
FT                   /db_xref="GOA:E3J3H1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H1"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ADP78173.1"
FT                   /translation="MNRPIRKVTIVCAVLFAALLVNANWVQVGDQHSLKQEPTNTREIA
FT                   ARLDRQRGGLLAGPANDRVTMASSTPVDDEFKYLRQYSDGRLYEPITGYFTLYSATGLE
FT                   HTENLFLNGDDDRLLASRVSALLSGSGRKGGYVLTTIDPKIQQAASAALNGRKGAVVAM
FT                   DPRTGAILAMVTAPTYDPNDLAGHNPDQVQKNYDALNADTNQPLLNRATQQTYPPGSTF
FT                   KLITAAAALSTGQYDINSVLPAPDRLKLPQSNTELPNFGGERCGNGQTDTMIHALTISC
FT                   NTAFASLGMQVGGDKLRAQAQAFGFNTTIDGFELPEAKSVFPSSLDQAQTAQSAIGQFD
FT                   DRVTPLQMAQVVSAIANHGRMMKPYLVDELEGPDLKQISKTQPKELGQPISSSVADELT
FT                   TMMKSVVTSGTGTKARISGVSVAGKTGTAEHGTNEPPHAWFVGFAPAENPSIAVAVVVE
FT                   DGGGESGTGGSVAAPIAQKVMQIALDVQG"
     gtgaaccggc cgatccggaa ggtcacgatc gtgtgcgccg tgctgttcgc ggcgctgctg        60
     gtcaacgcga actgggtgca ggtcggcgac cagcactcgc tcaagcagga accgacgaac       120
     accagggaga tcgcggcccg gctggaccgg cagcgcggcg gcctgctcgc cggcccggcc       180
     aacgaccggg tgacgatggc gtcctcgacg cccgtcgacg acgagttcaa gtacctgcgc       240
     cagtactcgg acggccggct gtacgagccg atcaccgggt atttcacgct gtacagcgcc       300
     accgggctgg agcacaccga gaacctgttc ctcaacggcg acgacgaccg gctgctggcc       360
     agccgggtca gcgcgctgct gtccggctct ggccgcaagg gcggctacgt gctgaccacg       420
     atcgacccga agatccagca ggccgcctcg gccgctctca acgggcgcaa gggcgccgtc       480
     gtcgcgatgg acccgcgcac cggcgcgatc ctcgcgatgg tgaccgctcc gacgtacgac       540
     ccgaacgacc tggccggcca caacccggac caggtgcaga agaactacga cgcgctgaac       600
     gcggacacca accagccgct gctgaaccgg gccacccagc agacctatcc gcccggctcc       660
     accttcaagc tgatcaccgc cgccgccgcg ctgtcgaccg ggcagtacga catcaattcg       720
     gtgctcccgg cgccggaccg gctcaagctc ccgcagagca acaccgagct gccgaacttc       780
     ggtggtgaac gctgtggcaa cgggcagacc gacacgatga tccacgcact gacgatctcc       840
     tgtaacaccg cgttcgcctc gctcggcatg caggtcggcg gggacaagct gcgcgcgcag       900
     gcgcaggcgt tcgggttcaa cacgacgatc gacggcttcg agctgcccga ggcgaagagc       960
     gtcttcccct cgtcgctcga ccaggcgcag accgcgcagt cggcgatcgg ccagttcgac      1020
     gaccgggtca ctccgctgca gatggcacag gtggtgtcgg ccatcgccaa ccacgggcgg      1080
     atgatgaagc cgtacctcgt cgacgagctc gaaggaccgg acctcaagca gatctccaag      1140
     acccagccga aggagcttgg acagcccatc tcgtcctcgg tagccgatga gctgacgacc      1200
     atgatgaaat ccgtcgtcac gtccggcacc ggtaccaagg cacgaatcag cggcgtgtcg      1260
     gtggccggca agacaggcac cgccgaacat gggacgaacg agccgccgca cgcctggttc      1320
     gtcgggttcg ccccagccga aaacccaagc atcgccgtcg cggtcgtggt cgaggacggc      1380
     ggcggagaat ccgggaccgg cggttccgtc gcggccccga tcgcgcagaa ggtcatgcag      1440
     atcgcattgg acgttcaagg atga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page