(data stored in ACNUC7421 zone)

EMBL: CP002299.PE89

CP002299.PE89        Location/Qualifiers
FT   CDS_pept        complement(105914..107746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0089"
FT                   /product="Protein of unknown function DUF2662"
FT                   /note="KEGG: fal:FRAAL6749 hypothetical protein; PFAM:
FT                   Protein of unknown function DUF2662; Forkhead-associated
FT                   protein; SMART: Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78177"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3H5"
FT                   /inference="protein motif:PFAM:PF12401"
FT                   /protein_id="ADP78177.1"
FT                   /translation="MGVLQRFERRLGGLVEGAFAKVFKGGVEPVEIAGALAREADDRRA
FT                   ISSNRVLVPNEFAVELASPDYNRLSPYSRALCDELAEMVREHAAEQRYTFVGPVSIRLS
FT                   EAPDLDVGVFRIRSSVASAEGMVATPQRRGSRAAPGVPRLLITNKEAPPGREREYELTA
FT                   ESTLIGRSVECDIRLTDTGVSRRHGEIRRMPDGNWLYVDAGSTNGSIVNGRPATQVKLV
FT                   NGDLIELGAALVTFQRDDGRGGRDSREPGRLGVEPPEPFGRPNDREPGGGPDAFRGGRG
FT                   VDRDGRLDPRDRLEPRDRLEPRDRPGPRGDQYRDRPDGPVRPDRPAGNRPDEPFNDRSG
FT                   ARGEPYRDRPPGPARADRPDRLGARPDEPFNDRSGARGEPYRDRQAGPARADRPRADEP
FT                   FDDRSGPRGEVFRDRSGARGEPYRDGPNGRPARPGPPRPEPQRDERPRHDPQRKDSPRP
FT                   GPPREPAQPEGPRPLGARRPAPADDRSGPRGARPRDEAYGGPSSARNEPNRDGPARLPR
FT                   DGRDARDARPRQDGDSDEYAGQGRGYGRRGDGSGPHPAGARRAGGRDAGGRDGRPPEEI
FT                   YDAETVLPSRAPGRPRSDDPRRRPGPPPPSDRSW"
     atgggtgtgc tgcagcgatt cgaacgccgc ctgggcggcc tcgtcgaggg cgcgttcgcg        60
     aaggtcttca agggcggcgt cgagccggtg gagatcgcgg gggcgctcgc ccgggaggcc       120
     gacgacaggc gggcgatcag ctccaaccgg gtgctggtgc cgaacgagtt cgccgtggag       180
     ctggccagcc cggactacaa ccgcctgtcg ccctacagcc gggccctgtg tgacgagctg       240
     gccgagatgg tccgcgagca tgcggccgag cagcggtaca cgttcgtcgg gccggtgagc       300
     atccggctgt ccgaggcgcc ggacctggac gtcggcgtgt tccggattcg cagcagcgtg       360
     gcgtcggcgg aggggatggt ggcgacgccg cagcggcgtg ggtcgcgagc cgcgccgggt       420
     gtgccccgac tgctgatcac gaacaaggag gccccgcccg gccgggagcg ggagtacgag       480
     ctcaccgccg agtcgaccct gatcggccgc agcgtggagt gcgacatccg gctgacggac       540
     accggggtct cccgccgcca cggcgagatc cgtcggatgc cggatggcaa ctggctctac       600
     gtggacgcgg gctcgacgaa cggcagcatc gtgaacgggc ggccggcgac gcaggtcaag       660
     ctcgtcaacg gggacctgat cgagcttggc gccgccctgg tcaccttcca gcgcgacgac       720
     ggccgaggcg gtcgagacag ccgcgaaccg ggccggctcg gggtcgagcc gccggagccg       780
     ttcggccgtc cgaacgaccg tgagcccggc ggtggtccgg acgccttccg cggcgggcgc       840
     ggcgtggacc gggacggccg tctcgacccc cgtgaccgcc tggaaccgcg cgaccgcctg       900
     gaaccgcgcg accgcccagg gccgcgcggc gaccagtacc gggacaggcc ggatggcccg       960
     gtcaggcccg accggccagc cggcaaccgc ccggacgagc cgttcaacga ccgctccggc      1020
     gcccgcggtg agccctaccg cgaccggccg cccggcccgg cccgagctga ccggccggac      1080
     cggctcggcg cccgcccgga cgagccgttc aacgaccgct ccggagcccg cggggagccg      1140
     taccgcgacc gccaggcggg gccggctcgg gccgaccggc cccgggcaga cgagccgttc      1200
     gacgaccgct cggggccgcg cggcgaggtc ttccgggacc gctccggagc ccggggcgag      1260
     ccgtaccggg acggacccaa cggccggccc gcccgcccgg gcccaccacg cccggagccg      1320
     cagcgcgacg agcgaccgcg ccacgaccca cagcgcaagg actcaccccg ccctgggccg      1380
     ccgcgcgagc ccgctcagcc cgagggccct cgtcccctgg gcgcccggcg cccggcgccg      1440
     gcggacgacc ggtcgggccc ccgcggcgcc cgcccgcgtg acgaggccta cggcggcccg      1500
     tcgagtgctc ggaacgagcc aaaccgggac ggcccggccc ggctcccgcg ggacgggcgg      1560
     gatgcccggg atgcccggcc ccgtcaggat ggcgacagcg atgagtacgc tggccaaggt      1620
     cgcggctatg gtcgccgtgg cgacgggagt gggccgcacc cggccggggc ccgccgtgcc      1680
     ggtggccgcg acgctggcgg ccgcgatggc cgcccgccgg aagagatcta cgatgccgag      1740
     acagtcctgc ccagccgggc gcctggtcgt cctcggtccg acgaccctcg ccgccggccg      1800
     ggcccgcccc cgccgagcga ccggagctgg taa                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page