(data stored in ACNUC7421 zone)

EMBL: CP002299.PE94

CP002299.PE94        Location/Qualifiers
FT   CDS_pept        111524..111727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78182"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6744"
FT                   /protein_id="ADP78182.1"
FT                   /translation="MTNGGAVDGPWISCPWCTGTVPLTYFAESDEEPGAQEAVCEACGR
FT                   RVSFLPPRPPDEPGDQAPSAAA"
     atgacaaatg gcggcgccgt cgacgggccg tggatcagtt gcccctggtg taccggcacg        60
     gtgccgctga catatttcgc cgaatccgac gaggagccgg gtgcccagga ggcggtctgc       120
     gaggcctgcg gccgccgggt ctccttcctg ccgccccggc cacccgatga accgggggac       180
     caggcgccct cggccgcggc ctga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page