(data stored in ACNUC7421 zone)

EMBL: CP002299.PE98

CP002299.PE98        Location/Qualifiers
FT   CDS_pept        complement(115952..116851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0098"
FT                   /product="protein of unknown function DUF178"
FT                   /note="PFAM: protein of unknown function DUF178; KEGG:
FT                   fal:FRAAL6735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78186"
FT                   /db_xref="GOA:E3J3I4"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:E3J3I4"
FT                   /inference="protein motif:PFAM:PF02621"
FT                   /protein_id="ADP78186.1"
FT                   /translation="MSQVTAASEADQRERTGLTLAISPCPNDTFAFHALAHGLVPGVPP
FT                   VSVTFADIDVLNARAADGLDDLVKVSYAALPWLLDGYRLLPAGGALGRGCGPLVLMSAG
FT                   GPTAAGAQGDAAVLRGARVAIPGTRTTAYLLFRLWAAGIDVATIDVLPFEKIMPAVQAG
FT                   RYDAGLVIHESRFTYPSYGLVSVADLGDWWEGATGLPIPLGAILARRDLPAESGDLAAA
FT                   VRASVAAAFANPAASAAWVLEHSQELAPEVVQAHIDLYVNDFSLDLGDEGYAAAEELLA
FT                   RAAAENLVPPLPSPLRQP"
     atgtcccagg tgacggcggc cagcgaggcg gaccagcgcg agcggacggg cctcacgctg        60
     gcgatttcgc cctgcccgaa cgacacgttc gccttccacg cgctcgcgca cggcctggtg       120
     cccggggtac cgcccgtgtc ggtcacgttc gccgacatcg acgtgctcaa cgcccgtgcg       180
     gccgacggcc tggacgacct ggtcaaggtc tcgtacgcgg ccctgccgtg gttgctcgac       240
     ggctaccggc tgctgccggc cggcggagcg ctgggacgcg gctgcggccc cctggtactc       300
     atgtccgccg gcggtcccac cgccgcgggc gcccagggag acgcggcggt gctgcggggg       360
     gcccgggtgg cgatccccgg gacccggacc accgcctacc tgctgttccg gctgtgggcg       420
     gcgggcatcg acgtcgcgac gatcgacgtg ctgccattcg agaagatcat gccggcagtc       480
     caggccggcc ggtacgacgc cgggctggtg atccacgagt cccggttcac ctacccgtcc       540
     tacgggctgg tgtccgtcgc cgacctgggc gactggtggg agggcgcgac cggcctgccg       600
     atcccgctcg gcgcgatcct ggcccgccgg gacctgcccg cggagtccgg cgatctggcc       660
     gcggccgtgc gggccagcgt ggcggccgcc ttcgccaacc cggcggcctc cgcggcctgg       720
     gtgctcgaac actcccagga gctggcgccc gaggtcgtcc aggcgcacat cgacctgtac       780
     gtcaacgact tcagcctcga cctcggcgac gagggctacg ccgcggccga ggagctcctg       840
     gcccgggccg ccgccgagaa cctggtcccc ccgctcccca gcccgctccg ccagccctag       900
//

If you have problems or comments...

PBIL Back to PBIL home page