(data stored in ACNUC7421 zone)

EMBL: CP002343.PE10

CP002343.PE10        Location/Qualifiers
FT   CDS_pept        13179..15890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0010"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="COGs: COG0188 Type IIA topoisomerase (DNA
FT                   gyrase/topo II topoisomerase IV) A subunit; InterPro
FT                   IPR002205: IPR006691: IPR005743; KEGG: kse:Ksed_00070 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller; PRIAM: DNA
FT                   topoisomerase (ATP-hydrolyzing); SMART: DNA
FT                   gyrase/topoisomerase IV subunit A; SPTR: Putative DNA
FT                   gyrase subunit A; TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   domain, beta-propeller; TIGRFAM: DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46572"
FT                   /db_xref="GOA:E6SDW9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDW9"
FT                   /protein_id="ADU46572.1"
FT                   /translation="MSDDLPPVDGDDILGPDETQPTEVDESHEQGTAPIERDPDQHDRV
FT                   EPIDLNTEMQRSYIEYAMSVIVSRALPDVRDGLKPVHRRIVYAMYDGGYRPDRGYNKCA
FT                   RVVGDVMGHYHPHGDSAIYDALVRLVQDWSMRYPLVDGQGNFGSRGNDGAAAPRYTECR
FT                   MASIALEMVRDIEQDTVDFIPNYDGKTMQPSVLPSRFPNLLVNGSAGIAVGMATQIPPH
FT                   NLREVAEGAQYYLHHPEISREELLEALLGIIKGPDFPTGSLIMGHRGIEDAYRTGRGSI
FT                   IMRAIVNVEEIKNRQCLVVTQLPYQVNPDQLAVKIADLVKDGKIAGIADIADETSGRTG
FT                   LRIVITLKRDAVAKVVLNNLYKHTQLQTTFGANMLALVDDVPRTLPLDGFIRHWVDHQI
FT                   EVIQRRTTFRLRKAEAEIHLLRGYLKALDMLDEVIALIRRSQTVEDARDGLIQLLDIDE
FT                   TQAQAILNMQLRRLAALERERIQQQHDELQELIDEYQAILASEVRQREIVSEELQGIVD
FT                   KYGDERRTEIVPFDGDMSMEDLIPEEDVVVTITRGGYAKRTRTDLYRSQRRGGKGVKGA
FT                   QLRGEDVVEHFFTTTTHHWLLFFTNLGRVYRAKGYELPEGSRDSKGQHVANLLAFQPGE
FT                   QIAQVLAIHDYEAADYLVLATRAGLVKKTRLRDYDSPRSGGLIAINLREGDELVGARLV
FT                   AAADDLLLVSRKGMSVRFTATDSALRPMGRSTSGVTGMKFRPGDTLLSMSRVPAETDVD
FT                   VFVVFENGLAKRTPVSEYRVQGRGGYGIQVAKLSEKGGDLVGALTVTGNDEVMVVMEKG
FT                   KIVRSRVDEVRHTSRSTQGVRFAAPDKGDAIVAVARNAESVTEEELEEVGDLEGTAPTS
FT                   PITTVPSTDGVPSDGSDEPTTESSDGDTGGDA"
     gtgagcgacg atctcccccc cgtcgacggc gacgacatcc tcggacccga cgagacgcag        60
     ccgaccgagg tcgacgagag tcacgagcag gggaccgccc cgatcgagcg cgaccccgac       120
     cagcacgacc gggtcgagcc gatcgacctc aacacagaga tgcagcgctc gtacatcgag       180
     tacgcgatgt cggtcatcgt gtcgcgcgcc ctgcccgacg tgcgggacgg cctcaagccg       240
     gtgcaccgcc gcatcgtcta cgccatgtac gacggcggct accggcccga ccgcggctac       300
     aacaagtgcg cgcgggtcgt cggcgacgtc atggggcact accatcccca cggcgactcg       360
     gccatctacg acgccctggt gcggctcgtg caggactggt cgatgcgcta cccgctcgtc       420
     gacggccaag gcaacttcgg gtcccgcggc aacgacggcg ccgcggcacc ccgctacacc       480
     gagtgccgga tggcgtcgat cgccctggag atggtccggg acatcgagca ggacaccgtc       540
     gacttcatcc ccaactacga cggcaagacg atgcagccgt ccgtgctgcc gagccgcttc       600
     ccgaacctcc tcgtcaacgg ctccgccggc atcgccgtcg gcatggccac ccagatcccc       660
     ccacacaacc tgcgcgaggt cgccgagggt gcgcagtact acctgcacca ccctgagatc       720
     tctcgcgagg agctgctcga ggcgctcctc gggatcatca agggccccga cttcccgacc       780
     gggtcgctca tcatgggcca tcgcggcatc gaggacgcct accggaccgg ccgcggctcg       840
     atcatcatgc gagccatcgt caacgtcgag gagatcaaga accggcagtg cctcgtcgtc       900
     acccagctgc cgtaccaggt caaccccgac cagctcgccg tcaagatcgc cgacctcgtc       960
     aaggacggca agatcgccgg catcgccgac atcgccgacg agacctcggg gcgcaccggc      1020
     ctgcgcatcg tcatcacgct caagcgtgac gccgtggcca aggtcgtgct caacaacctc      1080
     tacaagcaca cccagctgca gacgaccttc ggcgcgaaca tgctcgccct cgtcgacgac      1140
     gtgccacgga ccctgccgct cgacgggttc atccggcact gggtggacca ccagatcgag      1200
     gtcatccaac ggcggaccac gttccggctg cgcaaggccg aggccgagat ccacctgttg      1260
     cgcggctacc tcaaggccct cgacatgctc gacgaggtca tcgcgctcat ccgccgctcg      1320
     cagacggtcg aggacgcccg agacggcctg atccagctgc tcgacatcga cgagacccag      1380
     gcacaggcga tcctcaacat gcagctgcgc cgcctcgccg ccctcgagcg ggagcggatc      1440
     cagcagcagc acgacgagct ccaagagctc atcgacgagt accaggcgat cctcgcctcg      1500
     gaggtgcggc aacgcgagat cgtctccgag gagctgcagg gcatcgtcga caagtacggc      1560
     gacgagcggc gcaccgagat cgtcccgttc gacggggaca tgtccatgga ggacctcatc      1620
     cccgaggagg acgtcgtcgt cacgatcacc cggggcggct acgccaagcg gacgcggacc      1680
     gatctctacc ggtcacagcg ccgcggcggc aagggcgtca agggagccca gctgcgcggc      1740
     gaggacgtcg tcgagcactt cttcacgacg acgacgcacc actggctgct cttcttcacc      1800
     aacctgggcc gcgtctaccg ggccaagggg tacgagctgc cggaaggcag ccgcgacagc      1860
     aagggccagc acgtggccaa cctcctcgcg ttccagcccg gggagcagat cgcccaggtt      1920
     ctcgcgatcc acgactacga ggcggccgac tacctcgtcc tggcgacccg ggccggcctg      1980
     gtcaagaaga cccggctgcg cgactacgac tcgccccgct ccggcggcct catcgcaatc      2040
     aacctgcgcg agggcgacga gctcgtcggc gcccgtctcg tcgcagcggc cgacgacctg      2100
     ctcctcgtgt cgcgcaaggg catgtccgtg cggttcaccg ccacggattc ggcgcttcgg      2160
     ccgatggggc gctcgacgtc gggcgtgacc ggcatgaagt tccgccccgg cgacacgctc      2220
     ctgtcgatgt cccgcgtccc ggcagagacc gacgtcgacg tcttcgtcgt cttcgagaac      2280
     ggcctcgcca agcggacgcc ggtgtcggag taccgggtgc agggccgcgg tggctacggc      2340
     atccaggtcg cgaaactctc cgagaagggc ggcgacctcg tcggggcgct caccgtgacg      2400
     gggaacgacg aggtcatggt cgtcatggag aagggcaaga ttgtccgctc ccgggtcgac      2460
     gaggtccgtc acaccagccg cagcacccag ggcgtcaggt tcgcggcacc ggacaagggc      2520
     gacgcgatcg tggcggtggc ccgcaacgcg gagtccgtga ccgaggagga gctcgaggag      2580
     gtcggcgacc tggaaggcac cgcccccacg tcccccatca ctacggttcc gagcaccgat      2640
     ggcgtaccgt cggacggaag cgacgagccg acgacggagt cgtcggacgg cgacacagga      2700
     ggtgacgcat ga                                                          2712
//

If you have problems or comments...

PBIL Back to PBIL home page