(data stored in ACNUC7421 zone)

EMBL: CP002343.PE100

CP002343.PE100       Location/Qualifiers
FT   CDS_pept        108500..110347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0100"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="COGs: COG0747 ABC-type dipeptide transport system
FT                   periplasmic component; InterPro IPR000914; KEGG:
FT                   sro:Sros_5772 extracellular solute-binding protein; PFAM:
FT                   extracellular solute-binding protein family 5; SPTR:
FT                   Extracellular solute-binding protein; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 5 Middle"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46662"
FT                   /db_xref="GOA:E6SFC4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC4"
FT                   /protein_id="ADU46662.1"
FT                   /translation="MRRPTVPRLGVGATLLTALATTLVLGACTGPAATPGPASPSATTA
FT                   TATGRGTPASTTTSAERAPLVVETVFDFTSLDPRVLVERSGLLVADAAYETLTTLDPED
FT                   PTTVLPGLAEWTMSPERNWLTLRLRPDATFSDGTRVTSDDVVFTLARARGLGGTAAQLL
FT                   GPVGFTKVDDRTLTVITPGPNFALPAVLANPAFGILNADVVKQHGGAVGDGDTAGTWLS
FT                   WNSAGSGPYVVAEADAGRSITLQPNPHWSGPSPVFTEIVVRNAPPAQQVRDIESGAADV
FT                   VLDLPPDHADAMKLRPTVSSVAITSQTSPALAFLLLNDDQTVNRWTGNPDFVAAVRLGL
FT                   DLEAVTRRAGPGAVPALGLVPRGLPGAFEPPVPAATTPPTPTGRATGTAAPSPTSAPAS
FT                   VATSAPTSVPTSVPTSAATPTPSGTAAPIPTATPTTPRAGDLAAARAALARSGYRGEPI
FT                   RLSYASDRPLNGLDLRVVAAAIRDQLRPVGIRVVLAPAPMVKALSDYEKGLDVMGLWAW
FT                   TPEYAEPEAALAFAPGGHLAHRARWVRGVSSAMDALTAATRTSYGDERPGAFARWQLQM
FT                   EQFGPFVPLFQPAAHLAHGERVTAVPRTSIGSVDLAGIR"
     atgcgccgac ccaccgtccc gaggttgggc gtcggcgcca cgctgctcac cgccctcgcc        60
     acgacgctcg tcctcggcgc gtgcaccggg ccggccgcga ccccgggccc ggcgagcccg       120
     tcggccacga ccgccacggc gaccgggcgg ggcactcccg cctccacgac gacctccgcg       180
     gagcgcgccc ccctcgtcgt cgagacggtc ttcgacttca cctcgctcga tccacgggtc       240
     ctcgtcgaac gcagcggcct cctcgtcgcc gacgcggcct acgagacgct gacgacgctc       300
     gacccggagg accccaccac cgtgctgccg ggcctcgccg agtggaccat gtcacccgag       360
     cgcaactggc tcaccctgcg cctccgcccg gacgccacct tctcggacgg cacgcgcgtc       420
     acctccgacg acgtcgtctt caccctcgcc cgggcccgtg gcctcggcgg caccgcggcc       480
     caactcctcg gacccgtcgg cttcaccaag gtcgacgacc gcaccctgac cgtcatcacg       540
     ccgggcccga acttcgcgct gcccgccgtc ctcgccaacc cggccttcgg catcctcaac       600
     gccgacgtcg tcaaacagca cgggggcgcg gtcggcgacg gcgacaccgc aggcacctgg       660
     ctcagctgga actccgccgg ctccggcccc tacgtcgtcg ccgaggctga cgccggccgc       720
     agcatcaccc tccagcccaa cccccactgg tccggcccgt ctccggtgtt caccgagatc       780
     gtcgtccgca acgccccccc ggcccagcag gtccgcgaca tcgagtccgg cgcggccgac       840
     gtcgtgctcg acctgccccc cgaccacgcc gacgcgatga agctccgacc cacggtctcg       900
     agcgtcgcca tcacctcaca gacctcaccc gccctcgcct tcctcctcct caacgacgac       960
     cagaccgtca accggtggac cggcaacccc gacttcgtcg ccgcggtgcg cctcgggctc      1020
     gacctcgagg ccgtcacgcg ccgcgccggg ccgggcgccg tccccgcgct cgggctggtg      1080
     ccccgcggcc tgccgggcgc cttcgagcca cccgtcccgg ccgcgacgac gccgcccacc      1140
     ccgacgggaa gagcgaccgg gacggccgcg ccttcgccca cctccgcacc cgcgtccgta      1200
     gccacctcgg caccgacctc agtgccgacc tcagtgccga cctcagcggc cacgcccacg      1260
     ccgagcggga ccgccgcgcc cattccgacc gcgacgccga ccacgccccg ggccggggac      1320
     ctcgccgcgg caagggcagc gctggcccgc tccggctacc gtggggagcc gatccggctc      1380
     agctacgcga gcgaccgccc gctcaacggc ctcgacctcc gcgtcgtcgc cgcggcgatc      1440
     cgcgaccagc tcaggcccgt cgggatccgc gtcgtcctcg ctcccgcccc gatggtcaag      1500
     gccctctccg actacgagaa gggcctcgac gtgatgggcc tctgggcctg gacccccgag      1560
     tacgccgagc ccgaggcggc gctcgccttc gctccgggcg gccatctcgc tcaccgcgcc      1620
     cgctgggtcc gcggcgtgag ctcggcgatg gacgccctga cggcagcgac ccggacctcc      1680
     tacggcgacg agcgccccgg ggccttcgcg cgctggcagc tccagatgga gcagttcggt      1740
     ccgttcgtcc cgctcttcca gcccgccgct cacctcgccc acggcgaacg agtcaccgcc      1800
     gtgccacgca cgtcgatcgg ctccgtcgac ctcgccggga tccgctag                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page