(data stored in ACNUC7421 zone)

EMBL: CP002343.PE101

CP002343.PE101       Location/Qualifiers
FT   CDS_pept        110361..111044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0101"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2068 Uncharacterized MobA-related protein;
FT                   KEGG: nca:Noca_3976 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46663"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC5"
FT                   /protein_id="ADU46663.1"
FT                   /translation="MPLSPLPHVRGLLLAAGSGRRMGRPKALLRPAEGGRTLAERAVAV
FT                   LLEGGCDGVTVVVGAASDEVTAAVRASFPEEDVVDVVRCADWSEGMGASLRAGLTAMRP
FT                   HAQVQAVLVSLVDLPDLPAGAVHRVGRSGVGASSVEVSGVGVSGVAVGAGCLSRAAYGG
FT                   VPGHPTLIGRDHWAGVVAGARGDRGARDYLAVHDHVVVECGDLATGRDVDSPAGARRAG
FT                   LDASG"
     atgccgctga gtcccctccc gcacgtccgt ggcctcctgc tcgcggcggg ctccggccgc        60
     cggatgggcc ggcccaaggc gctgctgcgc cccgcagagg gcggccgcac cctcgccgag       120
     cgggccgtgg ccgtgctcct cgaggggggc tgcgacgggg tgaccgtggt ggtcggggca       180
     gcctcggacg aggtgaccgc cgccgtgcgg gcctcgttcc ccgaggagga cgtcgtcgac       240
     gtggtccgct gtgcggactg gtccgagggg atgggtgcgt cactgcgggc gggtctgacg       300
     gcgatgcggc cgcatgccca ggtccaggcg gtcctcgtct cgctcgtcga cctcccggac       360
     ctccccgccg gcgccgtgca ccgcgtcgga aggtcagggg tcggcgcgtc cagtgtcgag       420
     gtgtccgggg tcggcgtgtc cggggtcgcg gtcggcgccg gctgcctgag ccgcgcggcc       480
     tacggcgggg tcccgggtca cccgacgctc atcgggcgcg accactgggc cggagtcgtc       540
     gccggggcac gaggtgaccg cggcgcccgc gactacctcg cggtgcatga ccacgtcgtc       600
     gtcgagtgtg gtgacctcgc caccggtcgg gacgtcgact ctccggccgg ggcgcgtcgc       660
     gccggcctcg atgcgtccgg ttga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page