(data stored in ACNUC7421 zone)

EMBL: CP002343.PE102

CP002343.PE102       Location/Qualifiers
FT   CDS_pept        111125..112132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0102"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0714 MoxR-like ATPase; InterPro IPR003959:
FT                   IPR003593; KEGG: nca:Noca_3975 ATPase; PFAM: AAA ATPase
FT                   central domain protein; SMART: AAA ATPase; SPTR: ATPase;
FT                   PFAM: ATPase family associated with various cellular
FT                   activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46664"
FT                   /db_xref="GOA:E6SFC6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC6"
FT                   /protein_id="ADU46664.1"
FT                   /translation="MDTVSGLTAGPNAGQTAGQTAGQSTVQTKGQTTGSPPADSFADTF
FT                   ASPGDVAAALSRTGYLADDALATVTFLAIRLGRPILLEGEPGTGKTALAEALAEALGLQ
FT                   LIRLQCYEGIDATQALYDWDFPRQILHLRAVEALSRDDHRDPGQLETELFDERFLLARP
FT                   VLRALREAPCVLLIDEIDRADDEFEAFLLEVLSTWQVTIPEVGTLAATTPPIVVLTSNR
FT                   TRELHDALKRRCLYHWIDHPGLARELEIVRTRLPEVPAALAEQVVGVIQRLRTDVGLIK
FT                   PPGVAETLDWARALVALGAAALDPEVAAASLGSAVKYREDAERVRAMLDRLLTP"
     atggacaccg tctctggtct cactgcgggg cccaatgcgg gacagaccgc gggccagacc        60
     gcggggcaga gcaccgtgca gaccaagggg cagaccaccg ggagcccgcc cgccgactcc       120
     ttcgccgaca cctttgccag ccccggcgac gtcgcggcgg cgctcagccg gacgggctac       180
     ctcgcggacg acgccctggc cacggtgacc ttcctcgcca tccgcctcgg tcggccgatc       240
     ctcctcgagg gcgagcccgg gaccggcaag accgctctcg ccgaggctct ggccgaggcc       300
     ctcggcctgc agctgatccg gctccagtgc tacgagggca tcgacgcgac gcaggccctc       360
     tacgactggg acttcccccg ccagatcctg cacctgaggg ctgtcgaagc gctgtcacgc       420
     gacgaccacc gcgatccggg ccagctcgag acggagctct tcgacgagcg gttcctgctg       480
     gcccgccccg tgctgcgggc ccttcgggag gctccctgtg tgctgctcat cgacgagatc       540
     gaccgagccg acgacgagtt cgaggcgttc ctcctcgagg tgctgtccac gtggcaggtc       600
     acgattccgg aggtcggcac cctcgccgcg acgacgccgc cgatcgtcgt gctcacctcg       660
     aaccggaccc gggagctgca cgacgccctc aagcggcgtt gcctctacca ctggatcgac       720
     cacccgggac tggcccggga gctcgagatc gtccgcaccc gtctgccgga ggtcccggcc       780
     gccctcgcgg agcaggtggt gggggtcatc cagcgcctgc gcaccgacgt tggtctgatc       840
     aagccgcccg gggttgccga gacgctcgac tgggcccgcg ccctcgtcgc gctcggcgcg       900
     gccgcgctcg acccggaggt cgcggctgcc tcgctcggct ccgccgtgaa gtaccgcgag       960
     gatgccgagc gggtccgggc catgctcgac cgacttctga cgccatga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page