(data stored in ACNUC7421 zone)

EMBL: CP002343.PE104

CP002343.PE104       Location/Qualifiers
FT   CDS_pept        113276..114532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0104"
FT                   /product="protein of unknown function DUF182"
FT                   /note="COGs: COG1975 Xanthine and CO dehydrogenase
FT                   maturation factor XdhC/CoxF family; InterPro IPR003777;
FT                   KEGG: nca:Noca_3973 hypothetical protein; PFAM: protein of
FT                   unknown function DUF182; SPTR: Putative uncharacterized
FT                   protein; PFAM: XdhC and CoxI family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46666"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFC8"
FT                   /protein_id="ADU46666.1"
FT                   /translation="MREVLRELTRWWEAGDVVGVGTVVGTWRSAPRQPGASMLVGPGGE
FT                   AVGSVSGGCVEGAVYELGQEVVASGVPVLHRYGISDDDAFAVGLTCGGILDVFVEKVSK
FT                   ETFPELGAVAADIEAGRPVAVATVIEHPDPSWLGRRIVVHPEAVDEEATRVAGVVDDGA
FT                   ARGSVDAGASPAAYGLRMSLGSERADAAVRDDARGLLAQGRTATLGYGPDGERRGEGMR
FT                   VFVQSHAPKPRMLVFGAIDFAAAVARVGSFLGYHVTVCDARPVFATRSRFPDADEVIVR
FT                   WPHDYLTEEVEGGRVDPRTVVAVLTHDPKFDVPVLEVALRLPEVAYIGAMGSRRTHEDR
FT                   LRRLREAGLTDEELARMSSPIGLDLGARTPEETAISIAAEIIALRWGGQGERLSELGGP
FT                   IHHHEHLDVHADHPDVPSP"
     gtgcgtgagg tgttgcggga gctgacgagg tggtgggagg ccggcgacgt ggtcggcgtc        60
     ggcaccgtgg tcgggacgtg gcgctccgcg ccgcgccagc ccggggcgtc gatgctcgtc       120
     gggccgggcg gcgaggccgt cgggtccgtc tccggcggat gcgtcgaggg cgccgtctac       180
     gagctcggcc aggaggtcgt cgcctccggc gtcccggtgc tccaccgcta cgggatcagc       240
     gacgacgacg cgttcgcggt cggcttgacg tgcggcggca tcctcgacgt cttcgtcgag       300
     aaggtctcga aggagacctt ccccgagctc ggcgcggtcg ccgcggacat cgaggccgga       360
     cggcccgtcg cggtggccac ggtcatcgag caccccgatc ccagctggct cggtcgacgc       420
     atcgtggtgc atccggaggc ggtggacgag gaggccactc gagtggctgg ggtggtggac       480
     gacggggccg ctcgagggag cgtggacgcc ggagcgagcc cggcggcata cggcctgcgc       540
     atgtccctcg ggagcgagcg ggcggacgct gcggtgcgcg acgatgcgcg gggactgctc       600
     gcccaggggc gcacggcgac cctgggctac ggtcccgacg gggagcgccg cggcgagggg       660
     atgcgcgtct tcgtccagag ccatgcgccc aagccccgga tgctcgtctt cggtgcgatc       720
     gacttcgccg cggccgtcgc acgggtcggg agcttcctcg gctaccacgt caccgtctgc       780
     gacgcacgac cggtgttcgc cacgaggtcc cgcttccccg acgccgacga ggtcatcgtc       840
     cgctggccgc acgactacct caccgaggag gtcgagggcg gccgggtcga cccacggacc       900
     gtcgtcgcgg tgctgaccca cgacccgaag ttcgacgtgc cggtcctcga ggtcgcgctg       960
     cgcctcccgg aggtcgccta catcggcgcg atgggatccc gtcgcacgca tgaggaccgc      1020
     ctgcgacggc tgcgcgaggc cggcctgacg gacgaggagc tggcgcgcat gtcgtcaccg      1080
     atcgggctcg acctcggcgc gcggaccccg gaggagacgg ccatctccat cgcggccgag      1140
     atcatcgcac tgcgctgggg tggtcagggt gagcggctga gtgagctcgg cggtcccatc      1200
     caccaccacg agcacctcga tgtccacgcc gaccaccctg acgtgccgtc accctga         1257
//

If you have problems or comments...

PBIL Back to PBIL home page