(data stored in ACNUC7421 zone)

EMBL: CP002343.PE108

CP002343.PE108       Location/Qualifiers
FT   CDS_pept        complement(118545..119807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0109"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="InterPro IPR011701; KEGG: kfl:Kfla_6439 major
FT                   facilitator superfamily MFS_1; PFAM: major facilitator
FT                   superfamily MFS_1; SPTR: Major facilitator superfamily
FT                   MFS_1; PFAM: Bacterial protein of unknown function
FT                   (DUF894)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46670"
FT                   /db_xref="GOA:E6SFD2"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD2"
FT                   /protein_id="ADU46670.1"
FT                   /translation="MKELLRIRDARIALGARALSQLGDAMTLIALSILIAQTGQPLDLT
FT                   VLLVAFAAPVVALSSWAGRLVDTRDSRHLLTAAALVQVAGSAGLLASTSLGWQVGCILV
FT                   IQSGQAVAGPGWGALLPRIVGEEKVGRAIGLQQALGSAAWLAGTALGGLAFAAVGFHGV
FT                   ILIDTLAFGSLVGAALAVRTHRAGAGAGCPAPTPAPTPAPALESGWRILHRDRVSGLVV
FT                   AGLVLFVVALEGTNVVEAFLVIDVLGAGPAAYGLLGLCLGTGVTVGSVLCTRIDGDRRR
FT                   IAVLSAAAGTLGLTIAAAGLVGSVAWLYPLFVVAGLANGFINGLGFALVVGRTADAARG
FT                   RVLAAAMGTIRGGSVVSLLVAGVAAGWYGPRAVFVGAGLLTVTVAPVLLLARGRRAWAG
FT                   HGEPADASPGVTEVGAVEPAA"
     atgaaggaac tgcttcggat ccgggacgcg cgcatcgctc tcggtgcgcg ggctctgtcg        60
     cagctgggcg acgccatgac gctgatcgcc ctgtcgatcc tcatcgccca gaccgggcag       120
     cccctcgacc tcaccgtgct cctcgtcgcc ttcgcggcac cggtcgtcgc cctctcctcg       180
     tgggccggtc ggctcgtcga cacccgagac tcgcggcacc tcctcactgc ggcggcgctc       240
     gtgcaggtgg ccgggtccgc gggcctgctc gcctcgacct ccctcggctg gcaggtcggc       300
     tgcatcctcg tcatccagtc cggccaggcg gtggcgggac cggggtgggg ggccttgttg       360
     ccgcggatcg tcggcgagga gaaggtcggg cgggcgatcg ggctgcagca ggcccttggc       420
     tccgcagcct ggctcgccgg cacggccctc gggggactcg ccttcgcggc cgtcggcttc       480
     cacggcgtca tcctcatcga cacgctggcc ttcggctcgc tcgtcggcgc ggcgctggcc       540
     gtccggaccc accgggccgg cgccggcgcc ggctgccccg cgcccacccc ggcgcccacc       600
     ccggcgcccg cactcgagtc gggctggcgg atcctgcatc gcgaccgggt ctcgggcctc       660
     gtcgtggccg ggctcgtgct gttcgtcgtc gccctcgagg ggaccaacgt cgtcgaggcc       720
     ttcctcgtca tcgacgtcct cggcgccgga cccgcggcgt acgggttgct cggcctctgc       780
     ctcggcacgg gcgtgaccgt cggctccgtg ctgtgcacca ggatcgacgg ggaccgccgg       840
     cggatcgcgg tcctgtccgc cgccgccggc acgttgggcc tgacgatcgc ggcggcgggg       900
     ctggtgggtt cggtggcgtg gctctacccg ctcttcgtcg tcgccggtct cgccaacggc       960
     ttcatcaacg gactcgggtt cgcgctcgtc gtggggcgca ccgccgacgc ggcgcggggc      1020
     cgggtgctgg ctgccgccat ggggacgatc cgcggcgggt cggtggtctc cctcctcgtc      1080
     gccggggtgg cggccggctg gtacggaccg cgggcggtct tcgtcggcgc cgggctgctc      1140
     accgtcacgg tcgcgccggt gctcctgctg gctcggggac ggcgagcctg ggccggacac      1200
     ggcgaaccag ccgacgcgtc gcccggcgtc accgaggtcg gagcggtgga gccggcggcg      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page