(data stored in SCRATCH zone)

EMBL: CP002343.PE109

CP002343.PE109       Location/Qualifiers
FT   CDS_pept        119875..120465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0110"
FT                   /product="regulatory protein ArsR"
FT                   /note="InterPro IPR001845; KEGG: aau:AAur_3335 hypothetical
FT                   protein; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; SPTR: Putative uncharacterized protein; PFAM:
FT                   Bacterial regulatory protein, arsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46671"
FT                   /db_xref="GOA:E6SFD3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD3"
FT                   /protein_id="ADU46671.1"
FT                   /translation="MATLRRPTEALEVDDPRALRALAHPARQRIINELLAGRVMTATEA
FT                   AELVGLSPSAVSHHLRALERYGIAERAETGGDARTRPWRSRFTELSYVPRSPGGVQVAN
FT                   AVVRGELAKLARNIAVVVEANEAAQQAGERPAPRDSVGISVSERWLTDEERRDVVARIE
FT                   ELLRTLPERHSGNAPEGSVRMSLVLSFVPVAGD"
     atggccaccc tgcgccgtcc caccgaggca ctcgaggtcg acgacccccg ggccctacgg        60
     gctctcgccc atcccgcgcg acagcggatc atcaacgagc tgctcgccgg ccgcgtcatg       120
     acggcgaccg aggcagccga gctcgtcgga ctgtccccct ccgccgtgag ccaccacctg       180
     cgggcgctcg agcggtacgg gatcgctgag cgggcggaga cgggcggaga cgcacggacg       240
     aggccgtggc gctcgcggtt cacggagctg agctacgtgc ccaggtcccc gggcggcgtc       300
     caggtcgcca acgccgtggt ccggggcgag ctggccaagc tggcgcgcaa catcgccgtc       360
     gtcgtcgagg ccaacgaggc cgcgcagcag gcgggcgagc gcccagcccc gagggacagc       420
     gtcgggatca gcgtgagcga gagatggctg accgacgagg agcgccgcga cgtcgttgcc       480
     cggatcgagg aactgctccg caccctgccc gagcgacact ccgggaacgc gccggagggt       540
     tcggtccgga tgtccctcgt cctgtcgttc gtgcctgtcg cgggcgactg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page