(data stored in SCRATCH zone)

EMBL: CP002343.PE11

CP002343.PE11        Location/Qualifiers
FT   CDS_pept        15887..16534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_0008 hypothetical protein; SPTR:
FT                   Putative integral membrane protein; PFAM: Transmembrane
FT                   domain of unknown function (DUF3566)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46573"
FT                   /db_xref="GOA:E6SDX0"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX0"
FT                   /protein_id="ADU46573.1"
FT                   /translation="MSTPSSEGWGASRYGSDTDSLDYTGSGSADGESTLSRGAITSRTE
FT                   PTRAMGAQPTTATHPESVTTASQPAGDSTRAATAIAPARGKQATRSKKGPRRVRLAVAR
FT                   VDPWSVMKMSFLLSVALGIAGVILTAVLWMILSTMNVFTDIEGVLQSLQTAGSADNFSI
FT                   RDYVGFGRVVSLSIVIGVIDVILLTAIATVMAFLYNICSALVGGIQLTLTDD"
     atgagcacgc ccagctcaga ggggtggggc gcaagccgtt acgggtcgga caccgacagc        60
     ctcgactaca ccggctctgg gtctgcggac ggcgagtcca ccctctcccg aggcgcgatc       120
     acctcccgca ccgagccgac ccgagccatg ggcgcccagc ccacgacggc gacacacccc       180
     gagagcgtca ccaccgccag ccagccggca ggggactcca cgcgagctgc gacggccatc       240
     gccccggcac ggggcaagca ggcgaccagg agcaagaagg gcccacgccg ggtgcggctt       300
     gccgtggccc gcgtcgaccc ctggtccgtg atgaagatga gcttcctgct ctccgtggcg       360
     ctcggtatcg ccggcgtcat cctcaccgcg gtgctgtgga tgatcctgtc gacgatgaac       420
     gtcttcaccg acatcgaagg cgtcctccag tcgctccaga cggccggatc ggcagacaat       480
     ttctcgatcc gtgactacgt cggcttcggc cgcgtcgtct ccctgtcgat cgtgatcgga       540
     gtcatcgacg tcatcctcct gacggcgatc gcgacggtga tggccttcct ctacaacatc       600
     tgctcggcac tcgtgggcgg gatccaactg accctcaccg acgactga                    648
//

If you have problems or comments...

PBIL Back to PBIL home page