(data stored in ACNUC7421 zone)

EMBL: CP002343.PE114

CP002343.PE114       Location/Qualifiers
FT   CDS_pept        complement(125338..126273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0115"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="COGs: COG2423 ornithine cyclodeaminase mu-crystallin
FT                   homolog; InterPro IPR003462; KEGG: krh:KRH_11610 ornithine
FT                   cyclodeaminase/mu-crystallin family protein; PFAM:
FT                   ornithine cyclodeaminase/mu-crystallin; SPTR: Ornithine
FT                   cyclodeaminase/mu-crystallin family protein; PFAM:
FT                   Ornithine cyclodeaminase/mu-crystallin family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46676"
FT                   /db_xref="GOA:E6SFD8"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFD8"
FT                   /protein_id="ADU46676.1"
FT                   /translation="MEAPRWIDAAHIRRALSPEQARRLIREALEGDFDPAGDPARLAPV
FT                   VPGGQLLIMPSSTGDSVGVKVLSVAPGNPVRGLERIQALYVLFDADTLAPSVILDGSAI
FT                   TSLRTPAVSAVAVDALAPPTTRTLTVFGGGPQALGHVEAVLAVRQPERVVIVTRHLDGA
FT                   RATARRIDELGVETTALAAEDVRVRTAVGGSEVVVTATSAGTPVLDGSWVADGACVVAI
FT                   GSHEPDRRELDAALLGRSLVVVEDIGTALREAGDVVLAMGEGVLSTADLHPLKDLVTGA
FT                   VGRATDRPNVFKSVGMSWEDLVIAAGVARA"
     atggaggcgc cccgctggat cgatgcggcg cacatccgcc gggccctctc accggagcag        60
     gctcggcgcc tcatccgcga ggcgctggag ggcgacttcg accctgctgg ggacccggct       120
     cgactggcac ccgtggtccc gggcggccag ctgctcatca tgccttcgtc gacgggggac       180
     tcggtcggcg tcaaggtcct gtcggtggct ccgggcaacc cggtgcgggg gctcgagcgc       240
     atccaggccc tctacgtcct cttcgacgcc gacaccctcg ccccgtcggt catcctggac       300
     ggcagcgcca tcacgtcgct ccggactccg gcggtgtcag cggtggccgt ggacgcgttg       360
     gccccgccga caactcggac gttgaccgtc ttcggaggcg ggccgcaggc actgggtcac       420
     gtcgaggccg tgctcgccgt ccggcagccg gagcgggtcg tgatcgtcac gcgccacctc       480
     gacggggccc gggccacggc ccgacggatc gacgagctcg gagtcgagac gacggctctc       540
     gccgccgagg acgtgcgggt gcgcaccgcc gtcggcggct ccgaggtcgt cgtcacagcg       600
     acgtccgcag gcactcccgt cctggacggc tcctgggtcg ccgacggcgc gtgcgtcgtc       660
     gcgatcggct cgcatgagcc ggaccgccgc gagctcgacg cagcgctgct gggtcgctcg       720
     ctcgtcgtcg tcgaggacat cggcacggcc ctgcgcgagg cgggcgacgt cgtgctggcg       780
     atgggggaag gagtgctcag caccgcggac ctgcatccgc tgaaggacct ggtcaccggt       840
     gccgtcgggc gcgccaccga ccgcccgaac gtcttcaaga gcgtcggcat gtcctgggag       900
     gacctcgtca tcgcggccgg ggtggcgcgc gcctga                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page