(data stored in ACNUC7421 zone)

EMBL: CP002343.PE117

CP002343.PE117       Location/Qualifiers
FT   CDS_pept        complement(127414..128121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: btk:BT9727_0885 proline-threonine-rich
FT                   repeat-containing protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46679"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE1"
FT                   /protein_id="ADU46679.1"
FT                   /translation="MTTTIGMRRRAVWLITSVAFAATGALALSSATSATADEHNQWVYV
FT                   CKYVGTPGVDERLQTGQNPILVSVNAIDGPPVIGAPFQDAQGRSVVIGYGEPGGGQEGE
FT                   PEPVCPPELPPPPTETTTPPPTETTTPPTTETTTPPTTETTTPPTTETTTPPTTETTTG
FT                   TTPPEQPPGTTPPGAGGGVTPGPGAPDTGGGPAGGAGDSVPVNGLIGTGLLLGAAGILT
FT                   SEAVRRRRVVADG"
     atgacgacca cgatcggtat gcgtcgaaga gcggtctggc tcatcacgtc cgtcgccttc        60
     gccgcaacgg gtgcactcgc cctctcgagc gctacgtcgg ccacggccga cgagcacaac       120
     cagtgggtct acgtctgcaa gtacgtgggc acaccggggg tggatgagcg tctgcagacc       180
     gggcagaacc ccatcctcgt gtcggtcaac gcgatcgacg ggcccccggt catcggagcg       240
     ccgttccagg atgctcaggg ccgctccgtg gtgatcgggt acggcgagcc gggcggcggc       300
     caggagggcg agcccgagcc ggtgtgcccg ccggagctcc cgccgcctcc caccgagacc       360
     acgaccccgc ctcccaccga gaccacgacc ccgccgacca cggagacgac cacacctcca       420
     accaccgaga ccacgacccc gccgaccacg gagacgacca cacctccaac caccgagacg       480
     acgacgggca ccaccccgcc tgagcagccg ccggggacga cccctccggg tgcgggtggc       540
     ggcgtgacgc ccggaccggg cgcgccggac accggcggcg gcccggcggg tggcgcaggc       600
     gactccgtcc cggtcaacgg cctcatcggc acgggcctgc tgctgggcgc cgcgggcatc       660
     ctgacctccg aggcggtccg ccgccgccgc gtggtcgccg acggctga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page