(data stored in ACNUC7421 zone)
EMBL: CP002343.PE12
CP002343.PE12 Location/Qualifiers
FT CDS_pept 16735..16920
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="Intca_0012"
FT /product="hypothetical protein"
FT /note="KEGG: rsa:RSal33209_0010 hypothetical protein; SPTR:
FT Putative uncharacterized protein"
FT /db_xref="EnsemblGenomes-Gn:Intca_0012"
FT /db_xref="EnsemblGenomes-Tr:ADU46574"
FT /db_xref="UniProtKB/TrEMBL:E6SDX1"
FT /protein_id="ADU46574.1"
FT /translation="MLKRLALIAGAVASVAFIRKKARQQQAEQDLWNQATDDVKAQAPA
FT PAPSPAADQDLTAATS"
gtgctcaagc gtcttgccct catcgccgga gccgtcgcaa gcgtcgcctt catccgcaag 60
aaggcgcgcc agcagcaggc cgagcaggac ctgtggaacc aggccacgga tgatgtcaag 120
gcccaggctc ccgctccggc cccctcgccg gcggccgacc aggatctgac cgcggccaca 180
tcctga 186
//
If you have problems or comments...
Back to PBIL home page