(data stored in ACNUC7421 zone)

EMBL: CP002343.PE120

CP002343.PE120       Location/Qualifiers
FT   CDS_pept        complement(130146..130523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0121"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG4309 conserved hypothetical protein; KEGG:
FT                   pak:HMPREF0675_3286 hypothetical protein; SPTR: Conserved
FT                   protein; PFAM: Uncharacterized conserved protein (DUF2249)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46682"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE4"
FT                   /protein_id="ADU46682.1"
FT                   /translation="MYLAAGRSAKRRPPPGLSTIDWNPLNQEHPVTELSLTEKSQHSCG
FT                   CGCSDEGVPTLDVTVIPHAIRHATVFGAFSAIPAGGAMDLVAPHNPLPLLAQLQQQFGE
FT                   IGIEYLVEGPEAWTLRLTRPA"
     atgtatctcg cggccggccg gtccgccaaa cgccggccac caccaggcct gtcgaccatc        60
     gactggaacc cactcaacca ggagcatccc gtgaccgaac tgtccctcac cgagaagagc       120
     cagcactcct gcggctgcgg ctgcagcgac gagggcgtgc cgacgctcga cgtcaccgtc       180
     atcccccacg cgatccggca cgccaccgtc ttcggggcct tcagcgccat cccggccggc       240
     ggggcgatgg acctcgtggc accccacaac ccgctcccgc tgctcgccca gctgcagcag       300
     cagttcggcg agatcgggat cgagtacctt gttgagggcc cggaggcctg gacgctgcgg       360
     ctgacgcgcc cggcctga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page