(data stored in SCRATCH zone)

EMBL: CP002343.PE122

CP002343.PE122       Location/Qualifiers
FT   CDS_pept        131275..132492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0123"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="COGs: COG0303 Molybdopterin biosynthesis enzyme;
FT                   InterPro IPR005110: IPR001453: IPR005111: IPR020817; KEGG:
FT                   bcv:Bcav_1229 molybdenum cofactor synthesis domain protein;
FT                   PFAM: molybdopterin binding domain; MoeA domain protein
FT                   domain I and II; MoeA domain protein domain IV; SPTR:
FT                   Molybdenum cofactor synthesis domain protein; TIGRFAM:
FT                   molybdenum cofactor synthesis domain protein; PFAM:
FT                   Probable molybdopterin binding domain; MoeA N-terminal
FT                   region (domain I and II); MoeA C-terminal region (domain
FT                   IV); TIGRFAM: molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46684"
FT                   /db_xref="GOA:E6SFE6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE6"
FT                   /protein_id="ADU46684.1"
FT                   /translation="MGVGQNEPVPHTSVAEHRIALRHVIGAAATEVIPVDRHALGRRLA
FT                   EPLLAIDDLPRFDSSAMDGYAAVPETPDQRVFLVVGDVAAGDAAGFVLEPGQAARVMTG
FT                   ARLPTGAVGVVPVEQTDAERTGPAPRQVTFAAPVAPGRHVRKQAEDIAAGVPVAGTGAP
FT                   LTAAVIALARSAGCTEAVVHVPTRVAVVATGAELTVPGVDPGRGGIHESNSEMVAALAS
FT                   AAGCSVTRVATCTDDPGALEGLLTELSAAPDVDLVITTGGVSAGAYEVVRQVCEPRESF
FT                   SFVHLAMQPGGPQGLGRWDGMPVVCLPGTPVGAFVSFEMLVRPALDERHGAPARGASSA
FT                   AYVGRPRHTRAGMVQFISGVVAPDGTVSAPDARHLSALAGSNALIEVPETVEQIVPGDI
FT                   VTVHPL"
     atgggcgtgg gccagaatga gcccgtgccc cacacctccg tcgccgagca ccgcattgcc        60
     ctccgccacg tcatcggggc cgcggcgacc gaggtgatcc ccgtcgaccg gcacgccctc       120
     ggtcggcggc tggcggaacc gctcctcgct atcgacgacc tgcctcgctt cgacagctcg       180
     gcgatggacg gctacgcagc ggtccccgag acgcctgacc agcgggtctt cctcgtggtg       240
     ggtgacgtcg cggccggtga cgcggccggt ttcgtcctcg agcccggcca ggccgcccgc       300
     gtcatgaccg gcgcccggct gccgacgggt gcggtgggcg tcgtgcccgt cgagcagacc       360
     gacgcggagc ggaccggacc cgccccccgg caggtgactt tcgcggcgcc ggtcgcgccg       420
     ggtcgtcacg ttcggaagca ggccgaggac atcgcggccg gagtcccggt cgcggggacc       480
     ggggccccgc tcactgctgc ggtcatcgcg ctggcccgct ccgccggctg caccgaggcg       540
     gtcgtccacg tcccgacccg ggtcgcggtc gtcgccaccg gtgccgagct gacggtcccc       600
     ggcgtggacc ccggccgggg cggcatccac gagtcgaact ccgagatggt cgccgctctg       660
     gcgtccgccg ccgggtgcag cgtgacccgg gtcgccacct gcaccgacga cccgggtgcc       720
     ctggagggtc tgctcaccga gctcagcgca gcccccgacg tcgacctcgt catcacgacg       780
     ggcggtgtca gcgcgggcgc ctacgaggtg gtgcgccagg tctgcgagcc gcgcgagtcg       840
     ttcagcttcg tccacctcgc catgcagccg ggtggaccgc aaggtctggg ccgctgggat       900
     ggcatgccgg tggtctgcct gcccggcaca ccggtgggcg ccttcgtctc cttcgagatg       960
     ctggtgcgac cggcgctcga cgaacgccat ggtgccccgg cgcgcggagc cagctcagcg      1020
     gcatacgtcg gaaggccccg gcacacccgg gccggcatgg tccagttcat ctccggagtc      1080
     gtcgctcccg acgggaccgt cagcgcaccc gacgcgcgtc acctgtcggc gctcgcgggc      1140
     tccaacgcgc tcatcgaggt gcctgagacg gtcgagcaga tcgtcccggg agacatcgtc      1200
     accgtccacc cgctctga                                                    1218
//

If you have problems or comments...

PBIL Back to PBIL home page