(data stored in SCRATCH zone)

EMBL: CP002343.PE123

CP002343.PE123       Location/Qualifiers
FT   CDS_pept        complement(132595..132933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0124"
FT                   /product="YCII-related protein"
FT                   /note="InterPro IPR005545; KEGG: cfl:Cfla_1953 YCII-related
FT                   protein; PFAM: YCII-related; SPTR: Putative uncharacterized
FT                   protein; PFAM: YCII-related domain"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46685"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE7"
FT                   /protein_id="ADU46685.1"
FT                   /translation="MAIFAIQYTYPEDMTEQLKIRPDHRDWLTGLPGLRAAGMYQAGHD
FT                   EFSEGEVTVEEPPNGALIIVEADSLADVLATFEEDPYWAGGYVLRRVVREWNPPLGPWV
FT                   ADASQGNA"
     atggccatct tcgcgatcca gtacacctat cccgaggaca tgactgagca gctcaagatc        60
     cggcccgacc accgcgactg gctgaccggg ctgccggggc tccgcgccgc ggggatgtac       120
     caggccgggc acgacgagtt ctccgagggt gaggtgacgg tcgaggagcc acccaacggc       180
     gcgctcatca tcgtggaggc ggactcgctc gccgacgtgc tggcgacgtt cgaggaggac       240
     ccgtactggg ccggcggcta cgtgctgcgc cgggtcgtgc gcgagtggaa cccgccgttg       300
     gggccgtggg tcgccgacgc gagccagggc aacgcctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page