(data stored in SCRATCH zone)

EMBL: CP002343.PE124

CP002343.PE124       Location/Qualifiers
FT   CDS_pept        complement(132947..133801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0125"
FT                   /product="formate dehydrogenase subunit FdhD"
FT                   /note="COGs: COG1526 Uncharacterized protein required for
FT                   formate dehydrogenase activity; InterPro IPR003786; KEGG:
FT                   msm:MSMEG_0165 formate dehydrogenase accessory protein;
FT                   PFAM: formate dehydrogenase subunit FdhD; SPTR: Formate
FT                   dehydrogenase family accessory protein FdhD; PFAM:
FT                   FdhD/NarQ family; TIGRFAM: formate dehydrogenase family
FT                   accessory protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46686"
FT                   /db_xref="GOA:E6SFE8"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE8"
FT                   /protein_id="ADU46686.1"
FT                   /translation="MGRVTQRTKVTVVDVSGDRPTSRSRTDTVTVEEPLELRVGGTPLT
FT                   VTMRTPGHDIELVHGFLLTEGIIRDAADVSLARYCEGAVVSGESGFEENTYNVIDVTLA
FT                   PGVAQPAAELARNFFTSSSCGVCGKASIEQLRARTQWPVRDDATRWPAAVITAMPERMR
FT                   SEQRSFDKTGGLHAAGLFGPGGELLAVREDVGRHNAVDKVLGWALLSGRLPATGCVLMV
FT                   SGRASFELTQKALMGGVPCLAAVSAPSSLAVETASDAGMTLLGFVRGATLNVYSRGDRL
FT                   RFP"
     atgggacgtg tcacgcagcg caccaaggtc acggtcgttg acgtgtcggg cgaccgaccg        60
     acgagccggt cgcgcaccga caccgtcacc gtggaggagc cgctcgagct gcgcgtcggg       120
     ggcacaccgc tcacggtcac catgcgcacc cccggccacg acatcgagct cgtccacggc       180
     ttcctcctca ccgagggcat catccgagac gccgccgacg tcagcctcgc ccgctactgc       240
     gagggagccg tcgtctccgg ggagagcggc ttcgaggaga acacctacaa cgtcatcgac       300
     gtcaccctcg ctccaggggt ggcccaaccg gccgcggagc tggcgcggaa cttcttcacg       360
     tcgtcgtcct gcggagtctg cggcaaggcc tccatcgagc agctccgcgc gcgcactcag       420
     tggccggtcc gggacgacgc cacccgttgg ccggccgccg tgatcacggc catgcccgag       480
     cggatgcggt ccgagcagcg gtcgttcgac aagacggggg ggctgcacgc agcaggcctc       540
     ttcggcccgg gcggagagct cctcgcggtg cgcgaggacg tcggccggca caacgccgtc       600
     gacaaggtcc tcgggtgggc cctgctctcc gggcgcctcc cggccaccgg gtgcgtgctc       660
     atggtctccg gccgggcgtc cttcgagctg acgcagaagg ccctgatggg cggggtgccg       720
     tgcctggccg cggtgtccgc gccgtcgtcc cttgccgtcg agacggcgtc cgacgcgggg       780
     atgacgctgc tgggcttcgt ccgcggggcg acgctcaacg tgtactcccg cggtgaccga       840
     ttgcggtttc cctga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page