(data stored in SCRATCH zone)

EMBL: CP002343.PE125

CP002343.PE125       Location/Qualifiers
FT   CDS_pept        133827..134447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0126"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="COGs: COG0746 Molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A; KEGG: nml:Namu_2297
FT                   molybdopterin-guanine dinucleotide biosynthesis protein A;
FT                   SPTR: Molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46687"
FT                   /db_xref="GOA:E6SFE9"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFE9"
FT                   /protein_id="ADU46687.1"
FT                   /translation="MQPSLARAAAVVLTGGASSRMGRHKPAIHVAGRAIVERVVGAVGG
FT                   WPLVVVGSGAAVPEGTRVVSEEPPGGGPVAGIAAGWAALTTGTDAAGLAPSGPDVVLVL
FT                   AGDLPFLTRAHLEALVAAAEGSVAVTWSSTGPNWLCAAWPAELLRERLAAVGSPAGVSV
FT                   RRLLGDVPRVEVRDEADVATDVDTPEDLEAARRRADGSEAPGS"
     gtgcagccgt ccctcgcccg agccgccgcc gtcgtcctca ctggtggggc gtcgtcgcgg        60
     atgggccgcc acaagccggc catccacgtc gcgggccgcg ccatcgtcga acgggtcgtc       120
     ggggcggtgg gcgggtggcc cctcgtcgtc gtgggcagcg gtgccgccgt tcccgaaggg       180
     acgcgagtcg tctcggagga gcccccgggt ggggggccgg tcgccgggat cgccgctggg       240
     tgggctgccc tcaccaccgg gacggatgcc gctgggctcg ctcccagcgg accggacgtc       300
     gtcctcgtgc tcgctgggga tctgcccttc ctcacccggg cccacctcga ggccctggtg       360
     gccgctgccg agggctcggt cgccgtgacg tggtcgtcga ccggccccaa ctggctgtgt       420
     gccgcctggc ccgccgagct gctcagggag cggctggcgg ccgtcggctc gcccgccggg       480
     gtgagtgtgc ggcgcctcct gggtgacgtc ccgcgggtcg aggtgcggga cgaggcggac       540
     gtcgccacgg acgtcgacac cccggaggac ctggaggcgg cgcgacgccg cgctgacggg       600
     tcggaggcgc ccgggtcctg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page