(data stored in ACNUC7421 zone)

EMBL: CP002343.PE126

CP002343.PE126       Location/Qualifiers
FT   CDS_pept        complement(134497..135102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0127"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kfl:Kfla_5608 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46688"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF0"
FT                   /protein_id="ADU46688.1"
FT                   /translation="MGRTGLAVVAMSLAVGLGGCAGADRGSSGTPAPIDSQPATRTFAG
FT                   GPIGDSTEPLTTPLFPLTLRRTGGIAGYDDTVVLHADGKVLVDTRSVHGRVCQLTGPEQ
FT                   KHLLSLLNTLRLVDASVPTAGSTAATVPLPPEGDDQTSNDAILINITDHKLRPLDLRDP
FT                   SLGEVAGLVGALVADVTLSSPATTRCTTPTSPVPAPAT"
     atggggagga cgggactcgc ggtcgtcgcg atgagtctcg ccgtcggtct gggcgggtgc        60
     gccggggccg accgcggcag cagcggcact cccgcgccga tcgactcgca gcccgccacg       120
     cgcaccttcg ccggagggcc gatcggcgac tcgaccgagc cgctgaccac gccgctcttc       180
     ccgctcaccc tgcgccgcac cggcggcatc gcgggctacg acgacaccgt cgtgctccac       240
     gccgacggga aggtgctcgt cgacacccgc tccgtgcacg gcagggtctg ccagctgacc       300
     ggtcccgagc agaagcacct cctctcgctc ctcaacacgc tgcggctcgt cgacgcgagc       360
     gttccgaccg ccggctccac ggcggccacg gtccccctcc cgccggaggg cgacgaccag       420
     acgtccaacg acgccatcct catcaacatc accgaccaca agctgcgccc cctcgacctg       480
     cgcgacccct cgctcggtga ggtggccggt ctcgtcgggg cgctcgtcgc cgacgtgacc       540
     ctgtcgtcgc ccgccaccac ccggtgcacg actccgacca gcccggtccc cgcacccgcc       600
     acctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page