(data stored in ACNUC7421 zone)

EMBL: CP002343.PE128

CP002343.PE128       Location/Qualifiers
FT   CDS_pept        137209..138303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0129"
FT                   /product="Protein of unknown function DUF2183"
FT                   /note="COGs: COG4850 conserved hypothetical protein;
FT                   InterPro IPR019236; KEGG: kfl:Kfla_5428 hypothetical
FT                   protein; PFAM: Protein of unknown function DUF2183; SPTR:
FT                   Putative uncharacterized protein; PFAM: Uncharacterized
FT                   conserved protein (DUF2183)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46690"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF2"
FT                   /protein_id="ADU46690.1"
FT                   /translation="MSRPHAAAIIEDAFNEQVERLLRGRGWGNRVVTHIGYGTSTYVRV
FT                   FARIVLGRRGEAGPPERQDATGALVPRRYDRGWRVFVTAPAAGVPVVVTIGDREVYGRS
FT                   DRGGYIDVVAHDHGLGPGWQQVVVAAQGTDPVPADIFVVGDDVTFGIVSDIDDTVITTM
FT                   LPRPMIAAWNTFVRSGKSRRAVAGMAPMYRRLLAAHRGAPIVYLSTGAWNTTPTLTRFL
FT                   VEAGYPLGPFLMTDWGATNTGWFRSGQEHKRSALHRLARDFPHITWLLVGDDGQHDPQI
FT                   YAEFAEARPDRVGAVCIRQLTPTEQVLSHPMGRAEGPHRGWASRTAPTFLAPDGDGLLR
FT                   MLDEAGMVGEPVAADEQPSRPPVT"
     atgtcccgac cgcacgcggc cgccatcatc gaggacgcct tcaacgagca ggtcgagcgg        60
     ctcctgcgtg ggcgcggttg gggcaaccgc gtcgtcacgc acatcggcta cggcacgagc       120
     acctacgtcc gcgtcttcgc ccggatcgtc ctcggccgcc ggggtgaggc gggaccgccg       180
     gagcgacagg acgcgaccgg cgcgctggtc ccgcgtcggt acgaccgggg gtggcgcgtg       240
     ttcgtcacgg cgcccgccgc gggcgtcccc gtcgtcgtga ccatcgggga ccgggaggtc       300
     tacggccgct cggaccgggg cggctacatc gatgtcgtcg cccacgacca cggtctgggg       360
     ccgggctggc agcaggtcgt cgtcgcggca cagggcaccg acccggtgcc ggccgacatc       420
     ttcgtcgtcg gcgacgacgt caccttcggc atcgtcagcg acatcgacga caccgtcatc       480
     acgacgatgc tgccgcgtcc gatgatcgcc gcgtggaaca ccttcgtccg cagcggcaag       540
     tcgcgccggg cggtggccgg gatggcgccg atgtaccggc ggctgctcgc cgcccaccgc       600
     ggggccccga tcgtctacct ctcgacgggc gcgtggaaca cgacacccac actgacccgg       660
     ttcctcgtcg aggcgggcta tccactggga ccgttcctca tgacggactg gggtgcgacc       720
     aacacgggct ggttccggag cgggcaggag cacaagcgca gcgcgctcca ccggctggcc       780
     cgcgacttcc cgcacatcac ttggctcctc gtcggtgacg acggccagca cgatccgcag       840
     atctacgccg agttcgcgga ggcgcggccc gaccgggtcg gtgccgtctg catccgtcag       900
     ctgacgccca ccgagcaggt cctctcgcac ccgatggggc gagcggaggg gccgcaccgc       960
     gggtgggcga gccggaccgc gcccaccttc ctcgccccgg acggcgacgg gctgctgcgg      1020
     atgctcgacg aggcggggat ggtcggcgag ccggtcgcgg ccgacgagca gccctcccgc      1080
     ccgccggtga cctga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page