(data stored in ACNUC7421 zone)

EMBL: CP002343.PE129

CP002343.PE129       Location/Qualifiers
FT   CDS_pept        138440..139300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0130"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase;
FT                   Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="COGs: COG0266 Formamidopyrimidine-DNA glycosylase;
FT                   InterPro IPR012319: IPR015886: IPR000214; KEGG:
FT                   sna:Snas_1400 DNA-formamidopyrimidine glycosylase; PFAM:
FT                   DNA glycosylase/AP lyase, H2TH DNA-binding;
FT                   Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; PRIAM: DNA-(apurinic or apyrimidinic site) lyase;
FT                   SPTR: Putative formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycosylase H2TH domain;
FT                   Formamidopyrimidine-DNA glycosylase N-terminal domain;
FT                   TIGRFAM: formamidopyrimidine-DNA glycosylase (fpg)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46691"
FT                   /db_xref="GOA:E6SFF3"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF3"
FT                   /protein_id="ADU46691.1"
FT                   /translation="MPELPEVQALVDFLAERTAGLAVTKVELASISALKTFNPPPQSLE
FT                   GAPIDGVHRHGKFLDIDCDGTHLVFHLARAGWLRWSDQLPTTVLRPGKSPIALRVRLSD
FT                   GSGFDLTEAGTKKSLAAYIVRDPKEVPGVARLGPDPLADDFTLERFRELLTGRRTQIKG
FT                   LLRDQEVIAGVGNAYSDEILHVAKVSPFAIAGSLPPDVVDRLYAALRETLSSAVHAASG
FT                   KPAKELKDAKRAGMRVHARTGQACPECGDVVREVSFADTSLQYCATCQTGGKPLADRRM
FT                   SRLLK"
     atgcctgagc tgcccgaggt gcaggcgctc gtcgacttcc tcgccgagcg gacggccggc        60
     ctggccgtga cgaaggtcga gctggcctcg atcagcgcgc tcaagacgtt caacccgccg       120
     ccccagtcgc tcgagggggc acccatcgac ggggtgcaca ggcacgggaa gttcctcgac       180
     atcgactgcg acggcaccca tctcgtcttc cacctcgccc gggccggctg gctgcggtgg       240
     agcgaccagc tgccgacgac cgtgctgaga cccggcaagt ccccgatcgc cttgcgcgtc       300
     aggctctccg atggcagcgg cttcgacctg accgaggccg gcacgaagaa gtcgctcgcc       360
     gcctacatcg tccgcgaccc caaggaggtg cccggtgtcg cccggctcgg gccggacccc       420
     ctcgccgacg acttcacgct ggagcgcttc cgggagctgc tcaccggtcg gcggacccag       480
     atcaagggcc tgctccgcga ccaggaggtc atcgccgggg tcgggaacgc ctacagcgac       540
     gagatcctcc acgtggcgaa ggtcagcccc ttcgccatcg ccgggagcct gcccccggac       600
     gtggtggacc gcctctacgc agcgctccgc gagacgctgt cgagcgccgt gcacgctgct       660
     tcgggcaagc cggccaagga gctcaaggat gccaagcggg caggcatgcg cgtccatgcc       720
     cgcacgggcc aggcctgccc cgagtgtggc gacgtcgtgc gggaggtgag cttcgccgac       780
     acctcgctgc agtactgcgc cacctgccag accggtggca agccgctcgc cgaccggcgg       840
     atgtcccggc tgctcaagta g                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page