(data stored in SCRATCH zone)

EMBL: CP002343.PE130

CP002343.PE130       Location/Qualifiers
FT   CDS_pept        139346..140203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0131"
FT                   /product="Pyridoxal kinase"
FT                   /EC_number="2.7.1.35"
FT                   /note="COGs: COG2240 Pyridoxal/pyridoxine/pyridoxamine
FT                   kinase; InterPro IPR013749: IPR004625; KEGG: nca:Noca_4006
FT                   pyridoxamine kinase; PFAM: Phosphomethylpyrimidine kinase
FT                   type-1; PRIAM: Pyridoxal kinase; SPTR: Pyridoxal kinase;
FT                   TIGRFAM: pyridoxal kinase; PFAM: Phosphomethylpyrimidine
FT                   kinase; TIGRFAM: pyridoxal kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46692"
FT                   /db_xref="GOA:E6SFF4"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF4"
FT                   /protein_id="ADU46692.1"
FT                   /translation="MTSVKILSIQSHVAYGHAGNSAAVFPLQRLGHDVYPVLTVTFSNH
FT                   TGYGATRGPLIAPDDIAEVLLGIEERGAFPHIDAVLSGYQGAESVGAVILDAVARVKAA
FT                   NPSALYCCDPVMGDVGRGFFVREGIPEFIRDEVVPRADIITPNHFELEFLVGRPLATQQ
FT                   AVVAAAEELGARGPQVVLVTSTLTEDTPGDCIQMTCVAHAGAWVVTTPLLPMTVKGGGD
FT                   VTAALFLAHYLTDGPRLALVRTAATMHAILEGTHAAGSEEMLLVAGQDAIAQPGETVEI
FT                   SQIR"
     gtgacgagcg tgaagatcct gtcgatccag tcccacgtcg cctacggcca cgccggcaac        60
     tcggcggccg tcttcccgct ccagcggctc gggcacgatg tctaccccgt gctgacggtc       120
     accttctcca accacacggg ctacggtgcg acccgcggac cgctgatcgc accggatgac       180
     atcgccgagg tgctcctggg catcgaggag cgtggcgcgt tcccgcacat cgacgcggtc       240
     ctgtccggct accagggtgc ggagtcggtc ggtgcggtca tcctcgacgc ggtcgcgcgg       300
     gtcaaggccg cgaacccctc ggcgctctac tgctgcgacc ccgtcatggg tgatgtcggg       360
     cgggggttct tcgtccgcga ggggatcccc gagttcatcc gcgacgaggt ggtccctcga       420
     gccgacatca tcacccccaa ccacttcgag ctggagttcc tcgtcgggcg cccgctcgcg       480
     acccagcagg ccgtcgtggc ggcggccgag gagctgggcg ctcgcggtcc gcaggtcgtc       540
     ctcgtcacct cgaccctgac cgaggacact cccggcgact gcatccagat gacctgtgtc       600
     gcccatgccg gtgcctgggt cgtgacgact ccgctgctgc cgatgacggt caagggtggt       660
     ggcgacgtca cggcggcgct gttcctcgcg cactacctga ccgatgggcc acggctcgcg       720
     ctggtgcgca cggcggcgac gatgcacgcg atcctcgagg gcacccacgc cgcgggcagc       780
     gaggagatgc tcctcgtcgc ggggcaggac gccatcgccc aacctgggga aaccgtggag       840
     atttcgcaga ttcgttga                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page