(data stored in SCRATCH zone)

EMBL: CP002343.PE131

CP002343.PE131       Location/Qualifiers
FT   CDS_pept        140432..141694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0132"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR005829: IPR009056; KEGG: kse:Ksed_01160
FT                   hypothetical protein; SPTR: Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46693"
FT                   /db_xref="GOA:E6SFF5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF5"
FT                   /protein_id="ADU46693.1"
FT                   /translation="MDPITNPYAPGAGQRPPELAGRDEQLRTFDVVLERIARGRSERSI
FT                   VLTGLRGVGKTVLLNALRSSAVRADWGTGKLEARPDQRLRRPLAAAAHQAVRELGHPRG
FT                   DEVDQVLGIIKSFALRDAASGSKLRDKWQPGIDVPAVPGRADSGDIEIDLVELFTDIGG
FT                   LAADLGKGVAFFVDEMQDLGPEDVSAVCAACHEISQSGLPVIVVGAGLPHLPAVLSASK
FT                   SYSERLFRYQRIDRLPRDAADQALVGPAAEEGCAFTDEALEAMYSVTAGYPYFIQAYGK
FT                   VVWDVSPSSPISAQDIRVAAPEAESELAVGFFGSRFERATPAEREYLRAMADAALVRGP
FT                   GDQATTEGHGDAGASPAAYGIVDELDAVATSAVADLLGRKPQSLSPARDALIKKGLIYS
FT                   GERGQIAFTVPHFGRYLRTQA"
     gtggacccca tcacgaaccc gtacgccccg ggcgcggggc agcgtccccc cgagctcgcc        60
     ggccgcgacg agcagctgcg gaccttcgac gtcgtgctcg agcgcatcgc ccgcgggagg       120
     tcggagcggt cgatcgtcct caccggcctg cgcggagtgg gcaagaccgt cctgctcaac       180
     gcgctgcgat cctcggccgt gcgagcggac tggggcaccg gcaagctgga ggcgcggccc       240
     gaccagcggc tgcgtcggcc cctcgccgcc gccgcgcacc aggcggtgcg cgagctcgga       300
     caccctcggg gcgacgaggt cgaccaggtg ctcggcatca tcaagtcctt cgcgctgcgt       360
     gacgccgcga gcgggagcaa gctgcgggac aagtggcaac cgggcatcga cgtgcccgcc       420
     gtgcccggcc gggccgactc cggcgacatc gagatcgacc tcgtcgagct cttcaccgac       480
     atcggcgggc tcgccgccga cctcggcaag ggggtggcct tcttcgtcga cgagatgcag       540
     gacctcgggc ccgaggacgt ctccgccgtc tgcgcggcgt gccacgagat ctcccagtcc       600
     ggtctgcccg tcatcgtcgt cggggccggg ctgccgcacc tgccggccgt gctgtcggcc       660
     tccaagtcct actccgagcg gctcttccgc taccagcgca tcgaccggct gccccgcgac       720
     gccgccgacc aggccctcgt gggccccgcc gcagaggagg ggtgcgcgtt caccgacgag       780
     gcgctcgagg cgatgtactc cgtgaccgcc ggctacccct acttcatcca ggcctacggc       840
     aaggtcgtct gggacgtgtc cccctcctcg cccatctcgg cgcaggacat ccgggtcgcc       900
     gcaccggagg ccgagtccga gctcgcggtc ggcttcttcg gctcccggtt cgagcgggcc       960
     acgcccgccg agcgcgagta cctccgggcc atggcggacg ccgcgctcgt ccgggggccc      1020
     ggcgaccagg ccaccacgga aggccacggt gacgcgggag cgagcccagc ggcatacggc      1080
     atcgtcgacg agctcgacgc cgtcgcgacc tccgcggtgg ctgacctcct ggggcgcaag      1140
     ccccagtccc tctctcccgc acgggatgcg ctgatcaaga agggactcat ctactccggc      1200
     gaacgcgggc agatcgcgtt cacggtgccg cacttcgggc ggtacctgcg cactcaggcc      1260
     tga                                                                    1263
//

If you have problems or comments...

PBIL Back to PBIL home page