(data stored in ACNUC7421 zone)

EMBL: CP002343.PE132

CP002343.PE132       Location/Qualifiers
FT   CDS_pept        complement(141787..142146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0133"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR001607; KEGG: rop:ROP_38800 hypothetical
FT                   protein; SPTR: Zinc finger domain protein; PFAM: Zn-finger
FT                   in ubiquitin-hydrolases and other protein"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46694"
FT                   /db_xref="GOA:E6SFF6"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFF6"
FT                   /protein_id="ADU46694.1"
FT                   /translation="MAVPPGDLPDIDPTAPPSGTGCADCVAAGGWWVHLRRCAACGHVG
FT                   CCDTSPAQHATRHFRMTGHPVVRSFEPGETWFYDYRTQEFVEGPPLAPPDHHPEDQGVP
FT                   GPRDRVPPDWGDHLH"
     atggccgtcc ctcccggaga cctccccgac atcgacccga cggcgccccc gagcgggacc        60
     ggctgcgcgg actgcgtggc cgccggcgga tggtgggtcc acctgcggcg ctgcgccgcg       120
     tgcggacacg tcggctgctg cgacacctcg cccgcccagc acgcgactcg ccacttccgc       180
     atgaccgggc acccggtggt gcgcagcttc gagccgggcg agacgtggtt ctacgactac       240
     cgcacccagg agttcgtcga gggtccgccg ctggctcctc ccgaccacca tcccgaggac       300
     caaggcgtcc ccgggccgcg cgaccgggtt cccccggact ggggcgacca cctccactga       360
//

If you have problems or comments...

PBIL Back to PBIL home page