(data stored in ACNUC7421 zone)

EMBL: CP002343.PE136

CP002343.PE136       Location/Qualifiers
FT   CDS_pept        complement(144053..149638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0137"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="COGs: COG4770 Acetyl/propionyl-CoA carboxylase alpha
FT                   subunit; InterProIPR005481: IPR005479: IPR005482:
FT                   IPR000089: IPR 000022: IPR011761: IPR011764: IPR011763;
FT                   KEGG: kfl:Kfla_3307 carbamoyl-phosphate synthase L chain
FT                   ATP-binding protein; PFAM: Carbamoyl-phosphate synthase L
FT                   chain ATP-binding; Carbamoyl-phosphate synthetase large
FT                   chain domain protein; biotin carboxylase domain protein;
FT                   biotin/lipoyl attachment domain-containing protein;
FT                   carboxyl transferase; SPTR: Carbamoyl-phosphate synthase L
FT                   chain ATP-binding protein; PFAM: Carboxyl transferase
FT                   domain; Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Biotin carboxylase C-terminal domain; Acetyl-CoA
FT                   carboxylase, central region; Carbamoyl-phosphate synthase L
FT                   chain, N-terminal domain; Biotin-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46698"
FT                   /db_xref="GOA:E6SFG0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013537"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG0"
FT                   /protein_id="ADU46698.1"
FT                   /translation="MISRIAIVNRGEAAMRLIHAVRDLNAQHAVEGRSDQRIETIALHT
FT                   EGERRAMFVRESDHAYDLGPAANRPYIDHAVLERALRETGADAAWVGWGFVAEDPAFAE
FT                   LCERIGVIFIGPSAEAMRQLGDKIGSKLIAEEVGVPVAPWSRGGVDTLEEATEAAARIG
FT                   YPLMLKATAGGGGRGIRKVESDAELTEAYERTRDEAARAFGSGVVFLEKLVTGARHIEV
FT                   QVIGDGQGTAWAVGVRDCSVQRRNQKVIEESASPVLSADEAAEVRTAAERLAVAVGYAG
FT                   AGTVEFLYHPAEKFFAFLEVNTRLQVEHPITEATTDTDLVKLQIHVANGGRLEGARPVE
FT                   RGHAVEARLNAEDPDRDFAPAPGRIALLDFPSGPGIRVDTGVGEGDSIPADFDSMIAKI
FT                   IAYGRDRDEALARLRRAMAETTVVIEGGATNKSFILDLLDQPEVIDGSADTGWIDRVRG
FT                   EGRLMSQRHSGIALVAAGIEAYEEAEAIERARLLETARGGRPQAHHQVGRGVDLKLRGT
FT                   IHKVNVLRIAPHRYRVTVGSGASGDDGQVVEAQLDRIDDYQSRIVVGGQNHRLITALHG
FT                   PVLLVEVDGVTHRVSRDEGGVLRSPAPALVVAAPVQVGDEVAAGAPVLVLESMKMETVL
FT                   AAPFAARVKEILVGVGGQVETGAALVRLEPTGDEDEPGAGASPAPTVDLDLPDCTVADE
FT                   TLRDRIARGVSELSAGVLGFDNDDNGTHRSLTAYLSARDEAAADGTSPIAEEIILLELV
FT                   ADFAELSRNRPAEEERHTELLVHTPREHFHTYLQSLDADRAGLPAAFRDKLARVLRHYG
FT                   VTELDRTPDLEEAVFRIFLAQQRTSPEIALATSLLQRWLGEPTPEARNAAAARDTLDRL
FT                   VLATQLRFPVIGDLARSVRFRWFEQPMVDAERQSVLAGVRDQLESLTAEAERVGDEGGA
FT                   TPETVSPDYAAGIDELAAIPEQIVRFLAERLDRPDDSIPRHEPMIEVLIKRHYHEHDLH
FT                   GPHRFHAGDRPFAVADYTLDGRPTHLTSTIGDVAELAPGSDLDVSVGNDVWSRAEQHHA
FT                   VVDLYLRWRDQPADPEEVSATLATRLKALDWTRDVRRVAVAVTGNHDQPVGYFTFRPQG
FT                   EELVEDRLVRGVHPMVGRRLQLWRLRDFEVTRLEAPEDVFLYECVARDNADDRRIVASA
FT                   QVRQLVVVRDDDGRVSGLPQAERAIANCLDAIRRVRASRGSAGSRLDMNYVWVTIWPII
FT                   EADLEQLTALQAKIAPLTVGAGVEEVLVQARVVLDPEEGPVTIAGRFSYQPGSGVVGTV
FT                   GQPPAEPLKPLDDYASKVVRARRRGLVYPYELQSMIAGDGGTVVEHDLDDAGRLVPVDR
FT                   PFGLNKAGIIVALVTSPTERHPQGVQRVVLSGDPLRSLGSVAEAECARVIAALDLAEER
FT                   GIPVEWYSLSAGARISMDSGTENMDWVARALKRIIEFTQAGQEINIVVAGINVGAQPYW
FT                   NAEATMLMHTKGILVMTPDSAMVLTGKQSLDFSGGVSAEDNFGIGGYDRVMGPNGQAQY
FT                   WAKDLAAARDILMTHYDHAYVAPGEGGPRRVATSDPIDRDVTSYPHSLPDSGFTTVGDI
FT                   FSAEKNPDRKKPFDIRTLMRALTDQDHATLERWAGMADAETAVVQDAHLGGIPVCLIGI
FT                   ESKSVPRRGFPPTDGPDTYTAGTLFPRSSKKVARAINAASGNRPVVILANLSGFDGSPE
FT                   SMRSLQLEYGAEIGRAIVNFDGPIVFTVVSRYHGGAFVVFSKALNPRMTVLAIEGSFAS
FT                   VIGGAPAAAVVFARDVDARTAADSRVAELAARVDASEGVERAQLATELADLRATVRAEK
FT                   LGAVAAEFDSVHSIHRAVAVGSVDEVIEASDLRPRIISALEAGLTP"
     atgatctcgc gcatcgcgat cgtcaaccgc ggcgaggccg ccatgcgcct catccacgcc        60
     gtccgcgacc tcaacgccca gcacgcggtg gaggggcgca gcgaccagag gatcgagacg       120
     atcgcgctgc acaccgaggg tgagcgtcgt gccatgttcg tccgcgagag cgaccacgcc       180
     tacgacctcg gcccggccgc gaaccggccc tacatcgacc atgccgtcct cgagcgcgcg       240
     ctccgcgaga caggagcgga cgccgcgtgg gtcggctggg gcttcgtcgc cgaggacccg       300
     gccttcgccg agctgtgcga gcggatcggg gtcatcttca tcggtccgag cgccgaggcg       360
     atgcgccagc tcggcgacaa gatcggctcc aagctcatcg ccgaggaggt cggcgtcccc       420
     gtggccccgt ggtcgcgcgg cggcgtcgac acgctcgagg aggcgacgga ggccgcggcc       480
     cggatcggct accccctcat gctcaaggcc accgccggcg ggggtgggcg cgggatccgc       540
     aaggtcgagt cggacgccga gctgaccgag gcctacgagc ggactcgtga cgaggcggcg       600
     cgcgccttcg gctccggcgt cgtcttcctc gagaagctcg tcaccggtgc ccgccacatc       660
     gaggtccagg tcatcggcga cgggcagggc acggcgtggg ccgtcggcgt ccgggactgc       720
     tccgtccagc gccgcaacca gaaggtcatc gaggagtccg catcccccgt gctctcggcc       780
     gacgaggcag ccgaggtgcg cacggcggcc gaacggctcg cggtggcggt cggctacgcg       840
     ggggccggga ccgtcgagtt cctctaccac ccggccgaga agttcttcgc cttcctcgag       900
     gtgaacaccc gcctccaggt ggagcacccg atcaccgagg cgacgaccga cacggacctc       960
     gtcaagctgc agatccacgt cgcgaacggc ggtcgcctgg agggagcgcg tccggtcgag      1020
     cggggccacg ccgtcgaggc gcggctcaac gccgaggacc ccgaccgtga cttcgccccc      1080
     gccccgggac gtatcgcgct gctcgacttc ccctccggtc cgggcatccg ggtcgacacg      1140
     ggcgtcggag agggcgactc gatccccgcc gacttcgact cgatgatcgc caagatcatc      1200
     gcctacggcc gcgaccgtga cgaggccctg gcgcggctgc gccgggcgat ggccgagacg      1260
     acggtggtca tcgagggcgg ggcgacgaac aagagcttca tcctcgacct cctcgaccag      1320
     ccggaggtca tcgacggctc cgccgacacc ggctggatcg accgggtgcg cggcgagggg      1380
     cgcctcatgt cccagcgcca ctccgggatc gccctcgtgg cagccggcat cgaggcctac      1440
     gaggaggccg aggcgatcga gcgcgcccgc ctgctcgaga ccgctcgcgg cggccgcccg      1500
     caggcgcacc accaggtcgg ccggggcgtg gacctcaagc tgcggggcac gatccacaag      1560
     gtcaacgtcc tgcgcatcgc cccgcaccgg taccgggtca cggtcgggtc gggggcgagc      1620
     ggagacgacg gccaggtcgt cgaggcccag ctcgaccgga tcgacgacta ccagagccgc      1680
     atcgtcgtcg gtggccagaa ccaccgcctc atcaccgccc tgcacggtcc ggtgctcctc      1740
     gtcgaggtcg acggcgtcac ccaccgggtg tcccgcgacg agggcggcgt gctccgctcc      1800
     cccgcccctg ccctcgtcgt cgctgccccc gtgcaggtgg gcgacgaggt ggcggcgggc      1860
     gccccggtcc tcgtcctcga gtcgatgaag atggagaccg tgctggcggc tcccttcgcc      1920
     gcacgggtca aggagatcct cgtcggggtc ggcggccagg tcgagaccgg tgcggccctc      1980
     gtgcgactcg agccgacggg tgacgaggac gagcccggcg ccggcgcgag ccccgccccc      2040
     acggtcgacc tcgacctgcc ggactgcacc gtggccgacg agacccttcg cgaccggatc      2100
     gcccgcggcg tgtccgagct gtccgccggc gtcctcggct tcgacaacga cgacaacggc      2160
     acccaccgca gcctcaccgc ctacctgtcc gctcgggacg aggccgcagc ggacgggacc      2220
     agcccgatcg ccgaggagat catcctcctc gagctcgtcg ccgacttcgc cgagctgagc      2280
     cgcaaccgac ccgcggagga ggagcggcac accgagctgc tcgtccacac gcccagggag      2340
     cacttccaca cctacctgca gagtctcgac gccgaccggg ccgggttgcc ggccgccttc      2400
     cgggacaagc tcgcccgcgt gctgcggcac tacggcgtca ctgagctcga ccgcacgccg      2460
     gacctggagg aggcggtctt ccggatcttc ctcgcccagc agcgcacctc cccggagatc      2520
     gcgctggcga cctcgctcct ccagcgctgg ctcggcgagc cgacaccgga ggcgcggaac      2580
     gccgccgccg cccgcgacac cctcgaccgg ctcgtgctcg ccacccagct gcggttcccc      2640
     gtgatcggcg acctcgcccg tagcgtgcgc ttccgctggt tcgaacagcc gatggtcgat      2700
     gcggagcgtc agagcgtcct cgccggggtc cgggaccagc tcgagtccct gactgccgag      2760
     gccgagcggg tgggcgacga gggtggcgcg actcccgaga ccgtcagccc ggactacgcg      2820
     gcagggatcg acgagctcgc cgccatcccc gaacagatcg tccgcttcct cgccgagcgt      2880
     ctcgaccggc cggatgacag catcccgcga cacgagccga tgatcgaggt gctgatcaag      2940
     cggcactacc acgagcacga cctgcacgga ccgcaccgct tccacgcggg tgaccggccc      3000
     ttcgccgtgg ccgactacac gctcgacggc agacccaccc atctcacctc gacgatcggc      3060
     gacgtcgcgg agctcgctcc gggcagcgac ctcgacgtgt cggtcggcaa cgacgtgtgg      3120
     agccgcgccg agcagcacca cgccgtggtc gacctctacc tccgctggcg cgaccagccc      3180
     gctgacccgg aggaggtgag cgcgaccctc gccacgcgcc tcaaggccct cgactggacc      3240
     agggacgtgc gccgcgtggc cgtcgcggtc accggcaacc acgaccagcc cgtcggctac      3300
     ttcaccttcc gaccccaggg tgaggagctc gtcgaggacc gcctcgtccg gggcgtgcac      3360
     ccgatggtcg ggcgccgcct ccagctgtgg cggctgcgtg acttcgaggt cactcggctc      3420
     gaggccccgg aggacgtctt cctctacgag tgcgtcgccc gggacaacgc ggacgaccga      3480
     cggatcgtcg cctcggcgca ggtccgccag ctcgtcgtcg tccgtgacga cgacggtcgc      3540
     gtgtccgggc tcccgcaggc cgagcgggcc atcgccaact gcctcgacgc catccgacgc      3600
     gtgcgagcgt cccgcggctc ggcgggctcc cggctcgaca tgaactacgt ctgggtgacc      3660
     atctggccga tcatcgaggc cgacctcgag cagctgaccg ccctccaggc caagatcgcc      3720
     ccactgaccg tcggcgcggg cgtggaggag gtcctcgtcc aggcccgggt cgtcctcgat      3780
     cccgaggagg ggcccgtcac catcgccggc cggttctcct accagccggg ctcaggtgtc      3840
     gtcgggacag tgggacagcc gccggctgag ccgctcaaac cgctcgatga ctacgcctcg      3900
     aaggtcgtcc gcgcccgtcg ccgtggcctc gtctacccct acgagctgca gtcgatgatc      3960
     gccggcgacg gtgggaccgt ggtcgagcac gacctcgacg acgcgggtcg cctcgtcccg      4020
     gtggaccggc cgttcggcct caacaaggcc ggcatcatcg tcgctctcgt cacgtcgccg      4080
     accgagcgcc acccccaagg ggtccagcgc gtcgtgctca gcggcgaccc gctccgctcc      4140
     ctcggatcgg tggccgaggc ggagtgcgcc cgcgtcatcg cggcactcga cctcgcagag      4200
     gagcgcggca tcccggtcga gtggtactcg ctctcggccg gcgcacggat ctcgatggac      4260
     tccggcacgg agaacatgga ctgggtcgcc cgggcgctca aacggatcat cgagttcacc      4320
     caggcggggc aggagatcaa catcgtcgtg gccggcatca acgtcggcgc gcagccctac      4380
     tggaacgccg aggcgacgat gctcatgcac accaagggca tcctcgtcat gacgcccgac      4440
     agcgccatgg tcctgacggg aaagcagtcg ctcgacttct ccggtggcgt ctcggccgag      4500
     gacaacttcg gcatcggcgg ctacgaccgg gtgatgggcc cgaacggcca ggcgcagtac      4560
     tgggcgaagg acctcgctgc ggccagggac atcctgatga cccactacga ccacgcctac      4620
     gtcgctcccg gcgaaggcgg tccgcgccgg gtcgccacga gtgacccgat cgaccgcgac      4680
     gtcacgtcat acccccactc gctgcccgac tcgggcttca cgacggtggg cgacatcttc      4740
     tcagccgaga agaaccccga ccgcaagaag cccttcgaca tccggaccct gatgcgggcc      4800
     ctcaccgacc aggaccacgc gacgctcgag cgctgggccg gcatggcgga cgccgagacc      4860
     gccgtggtcc aggacgcgca cctcggtggc atcccggtgt gcctcatcgg catcgagtcg      4920
     aagtccgtcc cgcgccgcgg gttcccgccc accgacggtc ccgacaccta caccgcggga      4980
     acgctcttcc cccggtcgtc gaagaaggtc gcgcgagcca tcaacgcggc cagcggcaac      5040
     cggcccgtgg tcatcctcgc caacctgtcc ggcttcgacg ggtcaccgga gtcgatgcgc      5100
     agcctccagc tcgagtacgg cgcggagatc ggccgggcca tcgtcaactt cgacgggccg      5160
     atcgtcttca ccgtcgtctc ccgctaccac ggcggcgcct tcgtcgtctt ctccaaggcg      5220
     ctcaacccca ggatgacggt cctcgcgatc gaaggctcct tcgcctccgt catcgggggc      5280
     gcaccggcgg ccgccgtcgt gttcgcccga gacgtcgacg cgcgcacggc cgcggactcg      5340
     cgcgtcgccg agctcgccgc ccgggtcgac gcgtccgagg gagtggaacg cgcccagctg      5400
     gccaccgagc tggccgacct gcgggccacg gtgcgcgccg agaagctcgg agcggtcgcc      5460
     gccgagttcg acagcgtcca cagcatccat cgtgccgtgg ccgtggggtc ggtcgacgag      5520
     gtgatcgagg cgagcgacct ccggccccgg atcatctccg cgctggaggc ggggctcacc      5580
     ccctga                                                                 5586
//

If you have problems or comments...

PBIL Back to PBIL home page