(data stored in ACNUC7421 zone)

EMBL: CP002343.PE139

CP002343.PE139       Location/Qualifiers
FT   CDS_pept        complement(150862..151098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0140"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG4309 conserved hypothetical protein; KEGG:
FT                   nca:Noca_2100 hypothetical protein; SPTR: Putative
FT                   uncharacterized protein; PFAM: Uncharacterized conserved
FT                   protein (DUF2249)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46701"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG3"
FT                   /protein_id="ADU46701.1"
FT                   /translation="MTTDPQLDVRSEPPARRHTLILDTYHALTPGAGFELVNDHDPKPL
FT                   YYQFDAEYKDQFTWDYLEEGPDVWRVRIGRPAA"
     atgaccaccg acccccagct cgacgtccgc tccgagccgc cggcacgtcg ccacacgttg        60
     atcctcgaca cctaccacgc cctcaccccg ggcgctggct tcgagctcgt caacgaccac       120
     gaccccaagc cgctctacta ccagttcgac gccgagtaca aggaccagtt cacctgggac       180
     tacctcgagg agggcccgga cgtctggcgg gtccgcatcg ggcgacctgc cgcctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page