(data stored in ACNUC7421 zone)

EMBL: CP002343.PE14

CP002343.PE14        Location/Qualifiers
FT   CDS_pept        complement(18301..18504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0014"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="InterPro IPR010093; KEGG: saq:Sare_1579 DNA binding
FT                   domain-containing protein; SPTR: DNA binding domain,
FT                   excisionase family; TIGRFAM: DNA binding domain protein,
FT                   excisionase family; TIGRFAM: DNA binding domain,
FT                   excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46576"
FT                   /db_xref="GOA:E6SDX3"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E6SDX3"
FT                   /protein_id="ADU46576.1"
FT                   /translation="MTTYEIKRRWHTVAEVAEMLGYGETKVRMAIIAGDLKSVKDGKLR
FT                   RILPEWVDEYVALKVAESERNL"
     atgaccacct acgagatcaa gcgccgctgg cacaccgtcg ccgaggtggc cgagatgctt        60
     gggtacggcg agaccaaggt ccggatggcg atcatcgccg gcgacctgaa gtcggtgaag       120
     gacggcaagc tccgccgcat cctgcccgag tgggtcgacg agtacgtcgc gctcaaggtg       180
     gccgagtccg aacggaacct ctga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page