(data stored in ACNUC7421 zone)

EMBL: CP002343.PE140

CP002343.PE140       Location/Qualifiers
FT   CDS_pept        151319..152701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0141"
FT                   /product="tryptophanase"
FT                   /EC_number="4.1.99.1"
FT                   /note="COGs: COG3033 Tryptophanase; InterPro IPR001597:
FT                   IPR011166; KEGG: nca:Noca_1624 tryptophanase; PFAM:
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; PRIAM: Tryptophanase; SPTR: Tryptophanase; PFAM:
FT                   Beta-eliminating lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46702"
FT                   /db_xref="GOA:E6SFG4"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFG4"
FT                   /protein_id="ADU46702.1"
FT                   /translation="MDDAPFTTIIEPFRIHSVEPLTMTTRAERQDHLRTAGYNLFQLRA
FT                   QHVLIDLLTDSGTGAMSRDQWAAIQHGDESYAGSPSYYVFVDAVRELFPFEHVIPVHQG
FT                   RAAEKILFSALGGAGKVVPNNTHFDTTRANVEASGASAVDLVIAEGRDPVSDHPFKGNM
FT                   DLAALEALLAARADDVPCVMVTITNNSGGGQPVSLENLRGVREICDRYGKPLYLDACRF
FT                   AENAWFIREREEGQGDRDVSDIVREISGLADGMTMSAKKDPMGNIGGWLAMNDDDLAQR
FT                   CRNTLILTEGFPTYGGLAGRDLEALAQGLREVVQHDYLRYRIRSTAYLGEALVKLGVPV
FT                   LTPIGGHAVYIDARALAPHLSPLEYPGQAVAVALYELGGIRSCEIGTVMFGRQADGTEQ
FT                   PASMELVRLAIPRRTYTQSHIDYVIEVCERLAAVAPSLPGYRITSEPPVLRHFTASFEP
FT                   LR"
     atggacgacg cccccttcac gacgatcatc gagcccttcc ggatccactc cgtggagccg        60
     ctgacgatga ccacccgagc cgagcggcag gaccacctgc ggacggccgg gtacaacctc       120
     ttccagctgc gcgcccagca cgtcctcatc gacctgctga ccgactcggg caccggtgcg       180
     atgagccgcg accagtgggc ggccatccag cacggcgacg agtcctatgc cggctcaccc       240
     tcgtactacg tcttcgtcga cgccgtccgg gagctgttcc ccttcgagca cgtcatcccg       300
     gtgcaccagg gccgggccgc ggagaagatc ctcttctccg ccctcggtgg ggccgggaag       360
     gtcgtgccca acaacaccca cttcgacacg acgcgcgcca acgtcgaggc gagcggcgcg       420
     agcgccgtcg acctcgtcat cgccgaggga cgcgacccgg tgagcgacca ccccttcaag       480
     gggaacatgg acctcgccgc cctcgaggcg ctcctcgccg cacgcgccga cgacgtcccg       540
     tgcgtcatgg tgacgatcac gaacaacagc ggcggcgggc agccggtctc cctcgagaac       600
     cttcgcggcg tccgggagat ctgcgaccgc tacggcaagc cgctgtacct cgacgcgtgc       660
     cggttcgccg agaacgcgtg gttcatccgc gagcgcgagg agggccaggg cgaccgcgac       720
     gtcagcgaca tcgtccgcga gatctccgga ctcgccgacg gcatgacgat gagcgcgaag       780
     aaggacccga tgggcaacat cggcggctgg ctcgcgatga acgacgacga cctggcgcag       840
     cggtgccgca acaccctcat cctcaccgag ggcttcccga cctacggcgg gctcgccggg       900
     cgcgacctcg aggccctcgc ccaggggctg cgcgaggtgg tgcagcacga ctacctccgc       960
     taccggatcc gctcgaccgc ctacctcggc gaggcgctcg tcaagctcgg cgtgccggtg      1020
     ctgaccccga tcggtgggca cgccgtctac atcgacgccc gagccctcgc cccgcacctc      1080
     tcgccgctcg agtacccggg tcaggccgtg gccgtggcgc tctacgagct gggcgggatc      1140
     cggtcctgcg agatcgggac cgtcatgttc ggccgacagg ccgacggcac cgagcagccc      1200
     gcgtcgatgg agctcgtccg gctcgccatc ccgcggcgga cctacacgca gagccacatc      1260
     gactacgtca tcgaggtgtg tgaacggctg gccgcggtgg cgccgtcgct gcccggctac      1320
     cggatcacgt cggagccgcc ggtcctgcgc cacttcacgg cgtccttcga acccctgagg      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page