(data stored in ACNUC7421 zone)

EMBL: CP002343.PE141

CP002343.PE141       Location/Qualifiers
FT   CDS_pept        complement(152767..154188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0142"
FT                   /product="tyrosine phenol-lyase"
FT                   /EC_number="4.1.99.2"
FT                   /note="COGs: COG3033 Tryptophanase; InterPro IPR001597:
FT                   IPR011166: IPR013441; KEGG: sth:STH2842 tyrosine
FT                   phenol-lyase; PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; PRIAM: Tyrosine phenol-lyase;
FT                   SPTR: Tyrosine phenol-lyase; TIGRFAM: tyrosine
FT                   phenol-lyase; PFAM: Beta-eliminating lyase; TIGRFAM:
FT                   tyrosine phenol-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46703"
FT                   /db_xref="GOA:E6SFG5"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR013441"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:E6SFG5"
FT                   /protein_id="ADU46703.1"
FT                   /translation="MPAIAEPYRIKMVEPITMTTREQREAAIRAAGYNTFLLRSDDVYI
FT                   DLLTDSGTSAMSDRQWSAMMMGDEAYAGARSFDHLVESVRENYGFPLVCPTHQGRGAEH
FT                   LISKILITPGQHVPGNMYFTTTRVHQELAGGTFHDVIIDEAHDPASRHPFKGNVDLDKF
FT                   QALIDEVGADQIAYINVAVTVNMAGGQPVSMANIRAVREICDRYGIILWSDATRLAENA
FT                   WFIQEREDGYAGRPVAEIVREMLSHFDGITMSGKKDCLVNIGGFLAMRDEAILTKAREL
FT                   VVVYEGMPTYGGLAGRDLDAMAVGLREALDDDYLTHRIGQVRYLGERLQAAGVPIVEPI
FT                   GGHAVFIDAAAFLDHLSQDELPAQTLAAEIFLDSGVRSMERGIVSAGRDADGNNRYPKL
FT                   ELVRLTIPRRVYTNSHMDVVADSVIRVFQRRREIQGLTFVYESPTLRFFTSRFEPLAAE
FT                   AALEEGRPEPALAGA"
     atgccagcca ttgccgagcc gtaccggatc aagatggtcg aaccgatcac gatgacgacc        60
     cgggagcagc gcgaggccgc catccgcgcg gcgggataca acaccttcct gctccgcagc       120
     gacgacgtct acatcgacct gctgacggac tccggcacct cggcgatgag cgaccgccag       180
     tggagcgcga tgatgatggg cgacgaggcc tacgccggcg cacgctcgtt cgaccacctc       240
     gtcgagtcgg tgcgcgagaa ctacggcttc cccctggtgt gcccgacgca ccagggccgg       300
     ggcgcggagc acctgatctc caagatcctc atcacgcccg gccagcacgt ccccggcaac       360
     atgtacttca ccaccacccg cgtccaccag gagctcgccg gcggcacctt ccacgacgtg       420
     atcatcgacg aggcccacga ccccgcctcg cgccacccgt tcaaggggaa cgtcgacctc       480
     gacaagttcc aggcgctcat cgacgaggtc ggtgccgacc agatcgccta catcaacgtc       540
     gccgtgaccg tgaacatggc tgggggccag ccggtctcga tggccaacat ccgggccgtc       600
     cgcgagatct gcgaccgcta cggcatcatc ctgtggtccg acgcgacccg tctcgccgag       660
     aacgcctggt tcatccagga gcgcgaggac ggctacgccg gccggccggt cgccgagatc       720
     gtccgcgaga tgctctccca tttcgacggc atcacgatgt ccggcaagaa ggactgcctc       780
     gtcaacatcg gcggcttcct cgccatgcgc gacgaggcga tcctcaccaa ggcccgggag       840
     ctcgtcgtcg tctacgaggg catgccgacg tacggcggcc tggctggtcg ggatctcgac       900
     gcgatggccg tcgggctccg cgaggcgctc gacgacgact acctgaccca ccgcatcggc       960
     caggtccgct acctcggtga gcggctccag gcggccggcg tgccgatcgt cgagcccatc      1020
     ggcggtcacg cagtgttcat cgacgcggca gcgttcctcg accacctgtc gcaggacgag      1080
     ctccccgcac agaccctcgc cgccgagatc ttcctcgact ccggcgttcg cagcatggag      1140
     cgcggcatcg tgtccgccgg ccgcgacgcc gacggcaaca accgctaccc caagctcgag      1200
     ctggtccggc tcacgatccc ccggcgcgtc tacacgaact cccacatgga cgtcgtcgcc      1260
     gactccgtga tccgggtctt ccagcggcgc cgggagatcc agggcctgac gttcgtctac      1320
     gagtccccca cgctccgctt cttcacctca cgcttcgaac cgctcgcggc cgaggctgcc      1380
     ctggaggaag ggaggcccga accggcgctc gcgggcgcct ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page