(data stored in ACNUC7421 zone)

EMBL: CP002343.PE148

CP002343.PE148       Location/Qualifiers
FT   CDS_pept        complement(163956..164708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0149"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR002198: IPR002347;
FT                   KEGG: avi:Avi_0085 gluconate 5-dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46710"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH2"
FT                   /protein_id="ADU46710.1"
FT                   /translation="MRTALSGQRVWVVGASSGIGAQLADELVRRGASVAVSGRRASELE
FT                   AVSGGRMRSVPVDVTDADAVAEAADAVRDGLGGLDMVIHSAGYWKQFDAASWDREVFAR
FT                   HVEVNLLGLNNVLASVVPGFVEQGRGHVVGIASVAGYRGLAGSEAYGATKAAQLNLLEA
FT                   MRASLPPHGVRVTTVAPGFVRTEMTSVNEFPMPFLIDADEAGRTIADGLERGDDTIVFP
FT                   KRMAVAMAVARLVPGRLWTTLTSRGGRA"
     gtgaggacgg cgctcagcgg ccagcgggtc tgggtcgtcg gcgcgtccag cgggatcggg        60
     gcgcagctgg ccgacgagct cgtccggcgg ggcgcctcgg tagcggtcag cggacgccgg       120
     gcgagcgagc tggaggcggt gtcggggggg cgcatgcgca gcgtcccggt cgacgtcacg       180
     gacgccgacg ccgtggccga ggcggccgac gccgtccggg acggcctggg cggcctcgac       240
     atggtcatcc acagcgccgg ctactggaag cagttcgacg cggccagctg ggaccgcgag       300
     gtcttcgccc gccacgtcga ggtcaacctg ctcggcctca acaacgtcct cgcctcggtc       360
     gtgcccgggt tcgtggagca gggccgcggc cacgtcgtcg gcatcgcgtc ggtcgcgggc       420
     taccgcggcc tcgccgggtc cgaggcctac ggtgcgacca aggcggcgca gctcaacctc       480
     ctcgaggcca tgcgcgcgtc cctgccaccc cacggggtcc gggtgacgac ggtggcgccg       540
     ggcttcgtcc gcaccgagat gacctcggtc aacgagttcc ccatgccgtt cctcatcgac       600
     gccgacgagg cggggcgcac catcgccgac ggcctcgagc gcggtgacga caccatcgtc       660
     tttcccaagc ggatggcggt cgcgatggcg gtcgcccgtc tcgtccccgg ccggctgtgg       720
     acgacactca cctcccgggg tggccgggcg tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page