(data stored in ACNUC7421 zone)

EMBL: CP002343.PE150

CP002343.PE150       Location/Qualifiers
FT   CDS_pept        complement(166012..166767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0151"
FT                   /product="protein of unknown function DUF1365"
FT                   /note="COGs: COG3496 conserved hypothetical protein;
FT                   InterPro IPR010775; KEGG: rer:RER_23220 hypothetical
FT                   protein; PFAM: protein of unknown function DUF1365; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF1365)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46712"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH4"
FT                   /protein_id="ADU46712.1"
FT                   /translation="MSPSIRPPRVPSLVEGVVSHTRRTPVTHRFRHRHHQWLVDLDDLP
FT                   RLPWPLSVLARFDPADHLDGGHEEGGIRGDLDRFLASRGVALPAGARVLMLAHARSVGH
FT                   VFDPLSVFWCIAPDGRLVATVLEVHNTYGGRHAYLVDVDDHGRAVVDKAFYVSPFNDVS
FT                   GEYHVRLVLDEQRVAVAIRLTRDGQPILDASVSGRPRPATLRTILSTTARHALMTYRVT
FT                   ALIRWHGVRLWMRRLPVVPRPHRLEEAAR"
     gtgagcccgt ccatcaggcc gccccgggtc ccgagcctcg tcgaaggggt cgtgtcccac        60
     acccgccgga ccccggtgac gcaccgtttc cgccaccgcc accaccagtg gctcgtcgac       120
     ctggacgacc tgccccgcct gccgtggccg ctgtccgtcc tcgcccggtt cgaccccgcc       180
     gaccacctcg acggcggaca cgaggaaggc gggatcaggg gcgacctcga ccggttcctc       240
     gcgagccgag gggtcgccct gccagccggc gcgcgggtcc tcatgctcgc gcacgcccgc       300
     tccgtcgggc acgtcttcga ccccctgagc gtcttctggt gcattgcccc cgacggacgg       360
     ctcgtcgcga cggtcctcga ggtgcacaac acctacggag gccggcacgc ctacctcgtg       420
     gacgtcgacg accatggccg cgcagtggtc gacaaggcgt tctacgtctc tccgttcaac       480
     gacgtctccg gcgaatacca cgtccggctc gtcctcgacg agcagcgcgt cgccgtggcc       540
     atccggctca cccgggacgg tcagccgatc ctcgacgcct ccgtgtcggg tcggccgaga       600
     cccgccacgc tccgcacgat cctctcgacc accgcccgcc acgccctcat gacgtaccgc       660
     gtcacggccc tcatccggtg gcacggcgtg cgactgtgga tgcgacgcct gcccgtggtc       720
     ccccgcccac accgcctgga ggaggcagcc cgatga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page