(data stored in ACNUC7421 zone)

EMBL: CP002343.PE151

CP002343.PE151       Location/Qualifiers
FT   CDS_pept        complement(166764..168044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0152"
FT                   /product="amine oxidase"
FT                   /note="COGs: COG2907 NAD/FAD-binding protein; InterPro
FT                   IPR002937; KEGG: sgr:SGR_5877 putative amine
FT                   oxidoreductase; PFAM: amine oxidase; SPTR: Amine oxidase;
FT                   PFAM: Flavin containing amine oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46713"
FT                   /db_xref="GOA:E6SFH5"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH5"
FT                   /protein_id="ADU46713.1"
FT                   /translation="MNQSRPQTTAVIGAGVAGLTAAHVLSRTDAVTLFEADQRVGGHAH
FT                   THTVPAGGSTAGASPLRIDSGFIVHNERTYPHLLRLFAELDVETRPTEMSMSITCEQCG
FT                   LSYAGGRGLAGILAQPWRAADPRFVRLLTEVPRFHRAARRLLADPSAEPTWGEFLREGR
FT                   FSTYFVRHFAIPLVATVWSCGDLDAETYPARHLFQFLDHHGMLTVSGSPEWRTVVGGSA
FT                   TYVDRLVARLADVRRSAPVTAVERHDDGVDVRVGDAAPERFDRVVIATHANQALDLLAD
FT                   ALPQEKEDLAAIRYSRNTVWLHRDSSVLPAAKQARAAWNYRMQSCDAPSPQVAVSYWMN
FT                   RLQGLPGTEDHIVTLDPGDHVDPDTVTADLSYEHPVFTAPAVAAAGRLRSAGGERLAFA
FT                   GAHLGWGFHEDGCRSGVEAAQSFGVSW"
     atgaaccaga gccggccaca gaccaccgca gtcatcggcg cgggcgtcgc gggcctgacc        60
     gccgcgcacg tgctgtcccg gaccgacgcg gtgaccctct tcgaggcgga ccagcgagtc       120
     ggcgggcacg cccacacgca cacggtgccg gccggcgggt ccaccgccgg cgcgagcccg       180
     ctccggatcg acagcgggtt catcgtccac aacgagcgga cgtacccgca cctgctgcgc       240
     ctcttcgccg agctcgacgt cgagacccgc ccgacggaga tgagcatgag catcacctgc       300
     gagcagtgcg ggctctccta cgccgggggt cgcggtctgg ccggcatcct cgcccagccc       360
     tggcgggctg ccgacccgcg gttcgtccgg ctgctgaccg aggtcccccg gttccaccgc       420
     gccgccaggc gcctgctcgc cgacccgtca gccgagccga cctggggaga gttcctccgt       480
     gagggccgct tctcgaccta cttcgtgcgc cacttcgcca tcccgctcgt cgccaccgtc       540
     tggtcctgtg gtgacctcga cgccgagacc tacccggcac gacacctctt ccagttcctc       600
     gaccaccacg gcatgctcac cgtcagcggg tccccggagt ggcgcaccgt cgtcggcggc       660
     tcggcgacgt atgtggaccg cctcgtcgcc aggctggccg acgtgcgtcg gtcggccccg       720
     gtcaccgcgg tcgagcggca cgacgacggg gtcgacgtcc gggtcggcga cgccgcccca       780
     gagcggttcg accgggtggt catcgccacc cacgccaacc aggccctcga ccttctcgcc       840
     gacgcactgc cccaggagaa agaggacctc gccgcgatcc ggtactcgcg caacaccgtg       900
     tggctgcacc gcgactcgtc cgtgctgccg gccgcgaagc aggcccgcgc ggcatggaac       960
     taccggatgc agtcctgcga cgcgcccagc ccccaggtcg ccgtcagcta ctggatgaac      1020
     cggctccagg gcctccccgg caccgaggac cacatcgtca ccctcgaccc cggcgaccac      1080
     gtcgacccgg acacggtcac ggcggacctc tcctacgagc accccgtctt caccgcacct      1140
     gccgtcgccg cggccggccg gctccgctcg gccgggggtg agcggctcgc cttcgcggga      1200
     gcgcatctcg gctggggctt ccacgaggac ggctgccgct ccggcgtcga ggcggcccag      1260
     tcgttcgggg tgtcctggtg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page