(data stored in SCRATCH zone)

EMBL: CP002343.PE155

CP002343.PE155       Location/Qualifiers
FT   CDS_pept        170787..172568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0156"
FT                   /product="sulfate transporter"
FT                   /note="COGs: COG0659 Sulfate permease and related
FT                   transporter (MFS superfamily); InterPro IPR011547:
FT                   IPR002645: IPR001902; KEGG: cef:CE1093 putative sulfate
FT                   transport protein; PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; SPTR:
FT                   Putative sulfate transport protein; TIGRFAM: sulfate
FT                   transporter; PFAM: Sulfate transporter family; STAS domain;
FT                   TIGRFAM: high affinity sulphate transporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46717"
FT                   /db_xref="GOA:E6SFH9"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFH9"
FT                   /protein_id="ADU46717.1"
FT                   /translation="MTDQREGAAGWARFAPGLGVLLSYDRTWLRGDVLAGVTVSAYLVP
FT                   QVMAYAEVAGLPAITGLWACAPALVVYALLGSSRQLSVGPESTTALMTAAGIGALAGAA
FT                   GGGRHAELAALLALAVGVVCVLAWLVRLGFLAELLSKPVLVGYMAGIAALMVVSQLGKI
FT                   TGIEVESGTFLEEVGFTATHLGEVHGPTLAVASGVLVVLLAFGRWARRWPGPLIAMVSA
FT                   AALVHVLGLTDEGVRVVGEVPRGLPPLSVPQLDDVEIWKLLPAAVGVAVVAYSDNVLTG
FT                   RAFALKRRETIDSNQEFVALGAANIASSLASGFPVSSSGSRTVLANAMGARTQLHSLVS
FT                   VAVLAATMFWLGPVLATFPTAALGGVVVYAALRLVDVAELRRITGFRHSELVLSLATTV
FT                   AVLGFGVLPGIGVAIVLSVLDLLRRIVHPHDGVLGYVPNVAGMHDIDDHSNAVQVPGLV
FT                   VYRYDSPLFFANSHDFVRRALQAVADSQRTAPVEWFLLNAEANTEVDLTAVDALDTLRL
FT                   SLADEGIRFAMARVKQDMREPLDAAGFVDKVGEDHIFPTLPTAVAAYAKWYEEHHGRPL
FT                   EGLEIPPVPRQPRPPER"
     gtgaccgacc agcgcgaggg agccgccggg tgggcgcggt tcgcccccgg cctgggcgtg        60
     ctcctctcct acgaccggac ctggctgcgc ggcgacgtcc tcgccggcgt caccgtctcg       120
     gcctacctcg tcccacaggt catggcctac gcggaggtgg cggggctccc cgcgatcacc       180
     gggctgtggg cgtgtgcgcc ggccctcgtc gtctacgcgc tcctcgggtc gtcgcggcag       240
     ctgtccgtcg gccccgagtc gacgacggcc ctgatgaccg cggcgggcat cggcgctctc       300
     gcaggtgcgg ccggcggcgg tcgccacgcg gagctggctg ccctgctcgc cctcgccgtg       360
     ggcgtcgtct gcgtcctcgc gtggctcgtc cggctcgggt tcctcgccga gctcctgtcg       420
     aagccggtgc tcgtcggcta catggccggt atcgccgcgc tcatggtggt cagccagctc       480
     ggcaagatca ccgggatcga ggtggagagc ggcaccttcc tcgaggaggt cggcttcacg       540
     gcgacccacc tcggtgaggt gcacggtccc accctggcgg ttgcttccgg tgtcctcgtg       600
     gtgctgctgg ccttcggccg ctgggcgcgg cgctggccgg gcccgctcat cgcgatggtg       660
     tcggccgcgg cgctcgtcca cgtcctgggg ctgacggacg agggcgtccg ggtcgtgggc       720
     gaggtgcccc gggggctgcc cccgctgagc gtgccccagc tcgacgacgt cgagatctgg       780
     aagctcctgc cagcggccgt gggggtcgcg gtcgtggcct acagcgacaa cgtgctcacc       840
     ggtcgcgcct tcgccctcaa gcgccgcgag acgatcgaca gcaaccagga gttcgtcgcg       900
     ctcggcgccg ccaacatcgc gtccagcctc gcgtccgggt tcccggtcag ctcgagcggc       960
     agccgcaccg tgctcgccaa cgcgatgggg gcccgcacgc agctgcactc gctcgtgtcc      1020
     gtcgccgtcc tcgcggcgac gatgttctgg ctcgggccgg tgctcgcgac gttcccgacg      1080
     gcggccctcg ggggcgtggt cgtctacgcc gcgctgcgcc tcgtcgacgt ggccgagctg      1140
     cggcggatca ccggcttccg gcacagcgag ctggtcctct cgctcgccac gacggtggcg      1200
     gtcctcgggt tcggcgtcct gccgggcatc ggggtggcca tcgtcctgtc cgtgctcgac      1260
     ctgctgcggc ggatcgtcca cccgcacgac ggggtcctcg gctacgtccc caacgtcgcc      1320
     ggcatgcatg acatcgacga ccactccaac gccgtgcagg tgcccggtct ggtcgtctac      1380
     cgctacgact ccccactgtt cttcgccaac tcccacgact tcgtccggcg cgccctgcag      1440
     gcggtggccg actcccagcg gacggcgccg gtggagtggt tcctgctcaa cgccgaggcc      1500
     aacaccgagg tcgacctcac ggccgtcgat gccctcgaca cgttgcggct gtccttggcg      1560
     gacgagggga tccggttcgc catggcccga gtgaagcagg acatgcgcga gccgctcgac      1620
     gcagcggggt tcgtcgacaa ggtcggcgag gaccacatct tccccaccct gccgaccgcg      1680
     gtcgccgcct acgcgaagtg gtacgaggag caccacggcc gcccgctcga ggggctcgag      1740
     atcccgccgg tgccgaggca gccgcgcccc cccgagcgct ag                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page