(data stored in ACNUC7421 zone)

EMBL: CP002343.PE157

CP002343.PE157       Location/Qualifiers
FT   CDS_pept        173626..174459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Intca_0158"
FT                   /product="protein of unknown function DUF299"
FT                   /note="COGs: COG1806 conserved hypothetical protein;
FT                   InterPro IPR005177; KEGG: gob:Gobs_2870 protein of unknown
FT                   function DUF299; PFAM: protein of unknown function DUF299;
FT                   SPTR: Putative phosphotransferase JNB_14093; PFAM: Domain
FT                   of unknown function (DUF299)"
FT                   /db_xref="EnsemblGenomes-Gn:Intca_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADU46719"
FT                   /db_xref="GOA:E6SFI1"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/TrEMBL:E6SFI1"
FT                   /protein_id="ADU46719.1"
FT                   /translation="MSAPDSVTETPVFFLAGGTGISAETLGNLMLNQFPSVRFRRRKIP
FT                   FITTPEIARQVVAEMDEAMTDAVTPLVFSTVADEEVRTELVKTKCAFIDLFGSHLDAIE
FT                   RVLHVNASHNRAGLHGLGDPRRYEQRMKAIEYAMEHDDGQSLRNLAQAELILVAPSRCG
FT                   KTPTSMYLALQHGIRVANYPLVEEDLHSTHLPRPIRDYADRCFGLVSTPARLSQVRSER
FT                   RPGSTYASLAQCSYELRRAEALYRAHRIPSINSASMSVEEMAAVIMQTRHMSNLA"
     gtgagtgccc ccgacagcgt caccgagaca ccggtgttct tcctcgccgg cggcaccggc        60
     atctccgcgg agaccctggg caacctcatg ctgaaccagt tcccctcggt ccgcttccgg       120
     cgccgcaaga tcccgttcat caccacaccc gagatcgccc ggcaggtcgt cgccgagatg       180
     gacgaggcga tgaccgacgc ggtcaccccg ctcgtcttct cgaccgtcgc ggacgaggag       240
     gtgcggaccg agctcgtcaa gacgaagtgc gccttcatcg acctcttcgg cagtcacctc       300
     gacgccatcg agcgggtcct ccacgtcaac gcgagccaca accgggccgg cctgcacggg       360
     ctcggcgacc cgcgccgcta cgagcagcgg atgaaggcga tcgagtacgc catggagcac       420
     gacgacggcc agagcctgcg caacctcgcc caggccgagc tgatcctcgt cgccccctca       480
     cgctgcggca agacgccgac gtcgatgtac ctcgccctcc agcacgggat ccgggtcgcg       540
     aactaccccc tcgtcgagga ggaccttcac tccacccacc tgccccgtcc gatccgggac       600
     tacgccgacc ggtgtttcgg cctcgtctcg acgcccgcgc gcctcagcca ggtgcgcagc       660
     gagcggcgcc cggggtcgac ctacgcctcg ctggcccagt gcagctacga gctgcggcgg       720
     gccgaggccc tctaccgagc ccaccggatc ccctcgatca actcggcgtc gatgtcggtc       780
     gaggagatgg ccgcggtcat catgcagacc cggcacatga gcaacctcgc ctag             834
//

If you have problems or comments...

PBIL Back to PBIL home page